KEGG   Lactobacillus helveticus H10: LBHH_0210Help
Entry
LBHH_0210         CDS       T01959                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00450  Selenocompound metabolism
lhl00970  Aminoacyl-tRNA biosynthesis
lhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LBHH_0210
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBHH_0210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lhl01007]
    LBHH_0210
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lhl03016]
    LBHH_0210
Enzymes [BR:lhl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LBHH_0210
Amino acid related enzymes [BR:lhl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LBHH_0210
Transfer RNA biogenesis [BR:lhl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LBHH_0210
 Prokaryotic type
   Other AARSs
    LBHH_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADX69446
UniProt: F0NUE9
Position
222795..224771
Genome map
AA seq 658 aa AA seqDB search
MADKDTFYITTPIYYPSGRLTIGNAYTTIAADTMARYKRSQGYDTFFLTGTDEHGLKIEQ
KAEAQGIKPQEFVDKMAASYKKLWKSLDISYDKFIRTTDEEHVKAVQKIFEKLLKKGDIY
LGEYTGWYSVEDEEYFTESQLAEVYKDDNGNVIGGKAPSGHEVRLVKEPSYFFKMSKYAD
RLVEYYKEHPEFILPHSREKEMLNNFIKPGLEDLSVTRTTVNWGIPVPSDPKHVVYVWID
ALSNYITALGYGSDHDELFKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKHIIGH
GWVLMKNGKMSKSKGNAVYPESLTSRYGIDPLRYYLMRALPFGADGIFTPEDFIERINYD
LANDLGNLLNRTVSMINQYQDGQGAPVPVAQDKFGKDLQDTAASVIADYCEQMDSLHFSQ
ALDSIWKLVARANKYIDETTPWVLNKEGKKDELSHVMSNLAESLRLIAIMIYPVMTETAP
KMFEQLGLNWDDEDQKNLAFNDFGWNTKVVEKPKPIFPRLKAEEEVKYIKDEMAKAKPKK
TTRSEQKKGNEITIDDFDKVKIQVGQILSVEPVKGSNKLLMFKLDFGDGKERQILSGIRK
FYPDASELLDKKVLAVTNLKPRKMLGHLSEGMLLSSEKDGQVKLALVGDEHSVGAELG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagatactttttacattacaaccccgatttactatccatctggtagatta
actattggtaatgcttataccacaattgccgcagataccatggctcgttacaagcgtagt
caaggctacgacactttctttttaactggtactgacgaacacggcttgaagattgaacaa
aaggctgaagctcaaggaattaagccacaagaatttgtagataagatggctgcatcatac
aagaagttatggaagagcctcgatatttcttacgataaattcattagaactactgacgag
gaacacgttaaggctgttcaaaaaatctttgaaaagcttttaaagaagggcgacatttac
ttaggcgaatacactggttggtattcagttgaagacgaagaatacttcacagaatcacaa
cttgccgaagtttataaggatgataatggcaacgttattggtggtaaggctccaagtggt
catgaagtacgtttggttaaggaaccttcatacttcttcaagatgagcaagtacgctgac
agattggttgaatactataaggaacatcctgaatttattttgcctcactctcgtgaaaag
gaaatgcttaataacttcattaagccaggacttgaagatctttcagttactcgtactact
gttaactggggtattcctgtgccaagtgatccaaagcacgtggtttatgtttggattgat
gcactttcaaactatattactgctttaggctatggttcagatcatgatgaattgtttaag
aaatactggccagcagacgttcatttggtaggtaaggaaattgtccgcttccacaccatt
tattggccaattatgttgatggcacttgatttgccattgccaaaacatattattggtcac
ggctgggtattgatgaagaacggtaagatgtctaagtctaaaggtaacgccgtttaccca
gaatcacttactagccgttatggcattgatccacttcgttactacttgatgcgtgcactt
ccatttggtgcagatggtatcttcactcctgaagactttattgaaagaattaactacgat
ttggctaatgaccttggtaacttgcttaaccgtactgtttcaatgatcaaccaataccaa
gatggtcaaggtgcacctgttcctgttgctcaagacaagtttggcaaggacttgcaagat
acagctgctagtgtaattgctgactattgtgaacaaatggattcacttcatttctcacaa
gctttagatagtatttggaagttagtagcccgcgctaacaagtacatcgatgaaactacc
ccttgggtattgaataaagaaggcaagaaggatgaattgtctcatgtaatgagcaactta
gctgaaagcttgcgtttgatcgccatcatgatttatccagtaatgactgaaactgcacct
aagatgtttgaacaacttggcttgaactgggacgatgaagatcaaaagaatttagccttt
aatgattttggttggaacaccaaagttgttgaaaaaccaaagccaattttcccaagactt
aaggccgaagaagaagttaaatacatcaaggatgaaatggctaaggctaagccaaagaag
accactagaagtgaacaaaagaagggtaacgaaattaccattgacgattttgacaaggta
aagattcaagtaggtcaaattttgtcagtagaaccagttaagggctcaaacaagttgctt
atgttcaagcttgattttggcgatggtaaagaacgtcaaattttgagtggtattcgcaag
ttctacccagatgcaagtgaacttcttgataaaaaggtgttagctgttactaacttgaag
ccacgcaagatgttaggtcaccttagcgaaggcatgcttttatccagtgaaaaagatggt
caagttaaattagcacttgttggcgatgaacactcagttggagctgaattaggctaa

DBGET integrated database retrieval system