KEGG   Lactobacillus helveticus H10: LBHH_0284Help
Entry
LBHH_0284         CDS       T01959                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lhl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBHH_0284 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lhl03011]
    LBHH_0284 (rplV)
Ribosome [BR:lhl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LBHH_0284 (rplV)
  Bacteria
    LBHH_0284 (rplV)
  Archaea
    LBHH_0284 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADX69516
UniProt: F0NUU5
Position
310081..310365
Genome map
AA seq 94 aa AA seqDB search
MVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAIANAEHNYDLESANLYVSEAYVNE
GATLKRFRPRAKGMASPINKRTSHVVVVVSEKND
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgttgacttaattcgtggtaagagcgttgccgaagcattagcaatcttagaattt
acgcctagagctgcttccccaatcgttgaaaaagttttacgttcagcaattgctaacgca
gaacacaactacgatcttgaaagtgcaaatctttacgtatcagaagcatatgtaaacgaa
ggtgctactttgaagagattccgtccccgtgctaagggtatggcttctccaattaacaag
agaaccagtcacgtagttgtagtagtttcagaaaagaacgattaa

DBGET integrated database retrieval system