KEGG   Lactobacillus helveticus H10: LBHH_1415Help
Entry
LBHH_1415         CDS       T01959                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00010  Glycolysis / Gluconeogenesis
lhl00051  Fructose and mannose metabolism
lhl01100  Metabolic pathways
lhl01110  Biosynthesis of secondary metabolites
lhl01120  Microbial metabolism in diverse environments
lhl01130  Biosynthesis of antibiotics
lhl01200  Carbon metabolism
lhl01230  Biosynthesis of amino acids
Module
lhl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_1415 (tpiA)
   00051 Fructose and mannose metabolism
    LBHH_1415 (tpiA)
   00562 Inositol phosphate metabolism
    LBHH_1415 (tpiA)
Enzymes [BR:lhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBHH_1415 (tpiA)
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBHH_1415 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBHH_1415 (tpiA)
  Exosomal proteins of melanoma cells
   LBHH_1415 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADX70605
UniProt: F0NUV6
Position
complement(1478314..1479072)
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTAEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGIDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVGQIKAALDGLTAEQVSNLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKGLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaagttacacatgaatccagaacaaact
gctgaattcgttgacgctgttaaggacaagttgccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttaagaaaagcagctaagggctcaaactta
cacatcggtgctgaaaactgttactttgaagacgaaggtgcttacaccggtgaaacttca
cctaaggtcttgaaagaaatgggtatagactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggctaaggcaatctttgctaat
ggcttaaagccaattatttgctgtggtgaatcacttgaaacccgtgaagcaaacaagcaa
gaagactgggttgttggtcaaattaaggctgctttagatggtcttactgctgaacaagtt
tcaaaccttgttattgcttatgaaccaatctgggctattggtactggtaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgttaagggcttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaatgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system