KEGG   Lactobacillus helveticus H10: LBHH_1491Help
Entry
LBHH_1491         CDS       T01959                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase thil
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00071  Fatty acid degradation
lhl00072  Synthesis and degradation of ketone bodies
lhl00280  Valine, leucine and isoleucine degradation
lhl00310  Lysine degradation
lhl00362  Benzoate degradation
lhl00620  Pyruvate metabolism
lhl00630  Glyoxylate and dicarboxylate metabolism
lhl00640  Propanoate metabolism
lhl00650  Butanoate metabolism
lhl00900  Terpenoid backbone biosynthesis
lhl01100  Metabolic pathways
lhl01110  Biosynthesis of secondary metabolites
lhl01120  Microbial metabolism in diverse environments
lhl01130  Biosynthesis of antibiotics
lhl01200  Carbon metabolism
lhl01212  Fatty acid metabolism
lhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBHH_1491
   00630 Glyoxylate and dicarboxylate metabolism
    LBHH_1491
   00640 Propanoate metabolism
    LBHH_1491
   00650 Butanoate metabolism
    LBHH_1491
  Lipid metabolism
   00071 Fatty acid degradation
    LBHH_1491
   00072 Synthesis and degradation of ketone bodies
    LBHH_1491
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBHH_1491
   00310 Lysine degradation
    LBHH_1491
   00380 Tryptophan metabolism
    LBHH_1491
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBHH_1491
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBHH_1491
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBHH_1491
Enzymes [BR:lhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBHH_1491
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBHH_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADX70678
UniProt: F0NV29
Position
complement(1563031..1564194)
Genome map
AA seq 387 aa AA seqDB search
MMKNIYIVAAKRTPFGKYRGFFKDASSIDLGVMALKGALKAGNIDPNDVQELFMGNVLST
GLGENMARQVALNSGMRKESTAATINDVCGSSLKAVRLAQGQMELGDLDLVAVGGSESMT
RAPYFVKKENKENPADHLVNTMINDGLMDAFSGQHMGITAENVAQRYHVSREEMDEFSLR
SHKKAAEATKSGFFDNEILPIEINGETLDHDEPIRPDTSMAALSQLKPVFKEDGDVTAGN
SSPLTDGASMLVLATEDKVKDLNLKPIAKLGGFAEAGFDPAYMGYTPYFAVKKLLKKTGR
SINDYDIVELNEAFASQSVAVARDLQIPDDRLNIMGGAIALGHPLGATGTRLICSAISGL
KKEQGQRALVTLCIGGGQAIAYEIENI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaatatttatattgtagcggccaagagaacaccttttggcaagtatcgtgga
ttttttaaagatgcttcgtcaatcgatcttggtgtaatggcgttaaagggagctttaaaa
gcaggaaatattgatcctaatgatgttcaagaacttttcatgggaaatgtgttgagtaca
ggcttaggtgaaaatatggcccgacaggttgctcttaactcagggatgagaaaagaatca
actgcggcaacgattaatgatgtttgtggctcaagtcttaaggctgttcgtctggctcaa
ggtcaaatggaactaggcgacctggatttagtcgcagtgggtggtagcgaaagcatgact
cgtgcgccatattttgttaaaaaagagaataaagaaaatcctgcagatcatttagtaaat
actatgattaatgatggtttgatggatgctttttctggacaacatatggggattaccgct
gaaaacgttgctcaaagatatcatgttagtcgtgaagaaatggatgaatttagtcttcgt
tctcataaaaaagcggcagaggcaacaaaatccggcttttttgataatgaaattttgcca
attgaaattaatggtgagactttagatcatgatgaaccaattcgtcctgacacttctatg
gcagcattaagccaattaaaacctgtctttaaagaagatggtgatgtgacagctggcaat
tcctcaccgttaacagatggagctagtatgttggtattagccacagaagacaaggttaaa
gatttgaacttaaagccaatcgctaagctggggggctttgcggaggctggatttgatcct
gcttatatgggatatacgccatattttgctgtgaaaaaattgcttaaaaagacaggacgt
tcaattaatgattatgatatcgtggaactaaacgaagcttttgcttcacagagtgtagca
gtagcacgtgatttgcaaattcctgatgatagattgaatatcatgggcggtgctattgca
ttaggacatccgttaggtgctactggaactagattgatttgttctgcaatcagtggcttg
aagaaagagcaaggtcaacgtgcattagtaaccttgtgcattggcggtggccaagcaatc
gcatatgaaatcgagaatatctaa

DBGET integrated database retrieval system