KEGG   Lactobacillus helveticus H10: LBHH_1493Help
Entry
LBHH_1493         CDS       T01959                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00040  Pentose and glucuronate interconversions
lhl00052  Galactose metabolism
lhl00500  Starch and sucrose metabolism
lhl00520  Amino sugar and nucleotide sugar metabolism
lhl01100  Metabolic pathways
lhl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBHH_1493
   00052 Galactose metabolism
    LBHH_1493
   00500 Starch and sucrose metabolism
    LBHH_1493
   00520 Amino sugar and nucleotide sugar metabolism
    LBHH_1493
Enzymes [BR:lhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBHH_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADX70679
UniProt: F0NV30
Position
complement(1565948..1566847)
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNK
RPIEDHFDSNPELEQDLEEKSKSKLLKLTQGITNLGVNLYYTRQPHPAGLGDAIYRARSF
VGDEPFVVMLGDDLMDDQVPLTKQLIKRYDKTHASTIAVMPVPHEEVSKYGVIEPENEIM
PGLINVKSFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRCGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKDQLRAYIKKLSKQFEAEDKNNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagctgttattccagctgccggtttaggtactagattcttacctgca
acaaaggctttgcctaaagaaatgttgccaattgttgataaaccaacaattcaatttatt
gtagaagaagccaagaagtctggtattgaggatattttgatcgttattggtaagaataag
cgaccaattgaggatcattttgattctaatccagaacttgaacaagacttggaagaaaag
agcaaaagcaaattgcttaaattgacccaaggaattaccaatttgggtgtcaatttgtac
tatactagacaaccacatccagctggtttaggggatgcaatttatcgtgctcgtagcttt
gttggtgatgaaccatttgtagtaatgcttggtgatgatttgatggatgatcaagtgcct
ttaaccaagcaattgattaagcgttacgacaagacacatgcctctactatcgctgtaatg
cctgtacctcatgaagaagtttctaaatatggggtaattgaacctgaaaatgaaatcatg
cctggtttgatcaacgttaagtcttttgtagaaaagcctgatgttgataaagctccaagt
gattacgctattattggccgttacttgcttacaccagaaatttttgatattttggctcat
caaaaaccaggtcgttgcggagaaattcaattaacagatgccattgatacgatgaataag
acacaacgcgtgtttgctcatgtatttaaaggtgaacgtcatgatgttggtaataaagag
ggctaccttgaaacctctattgaatatggactaaagcatcctgagattaaggatcaatta
cgtgcatatattaagaagttatctaagcaatttgaagcggaagataaaaataataaataa

DBGET integrated database retrieval system