KEGG   Lactobacillus hokkaidonensis: LOOC260_103600Help
Entry
LOOC260_103600    CDS       T03598                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lho  Lactobacillus hokkaidonensis
Pathway
lho00900  Terpenoid backbone biosynthesis
lho01110  Biosynthesis of secondary metabolites
lho01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOOC260_103600
Enzymes [BR:lho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LOOC260_103600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: BAP84934
UniProt: A0A0A1GV62
Position
383499..384764
Genome map
AA seq 421 aa AA seqDB search
MADWRHGFYKLTRAQRQSLVARQFDLSAQQEQLLNQQVDPVNQEMVENYLTSYHLPQGIA
VNLVVDQQEYVVPMVTEEPSVIAAASNGAKLVAKSGGFQTTADTAMMIGQVVLTQVDNTI
IDWLKQHESELLQVANQAKPSMQRRGGGAKKAQLRSLKHGWVSIDLMIDTDEAMGANSVN
TMCEAVGNWLSDNGLHVLTAILSNLATQSLQTATCKINAADLVTESMSGDEVGQRIADLS
ELAQIDPYRATTHNKGIMNGIDAVLIATGNDWRAIESGAHAYAAIGGVYKGLSTWRFEKS
QLIGSITLPLPVGIVGGSIDIVPLVKINQRIMKVNSAQQLAQVIASVGLAQNLAALRALA
TNGIQVGHMKLQYRSLALSVGAKPAEIDALVARLQNEQHVDHQFAIQELEQLRKELNNGR
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagattggcgacatggattttacaaattaacacgagcgcagcgacagtcgttggtc
gcccgtcaatttgatttgtctgcgcagcaagaacaattattgaaccaacaagttgacccg
gtgaatcaagaaatggttgaaaactatttaactagttatcatttaccacaaggcatcgct
gttaatttggtggttgatcagcaagaatatgtcgtgccaatggtaactgaagagccatct
gtgatcgctgcagccagcaatggcgctaaattagtagctaaaagtggtggctttcagacg
actgcagatactgccatgatgattggccaggttgttttgacgcaggtagataacacaatc
attgattggcttaaacaacacgagtcggagctgttgcaagtagctaatcaggctaaacca
tcaatgcaaagacgtggcggtggtgccaagaaggcgcaattgcggtcgttgaaacatgga
tgggtatcaattgacttaatgattgatactgatgaagcaatgggggctaatagcgtcaat
acaatgtgtgaggctgttggtaactggttgtctgataatggcttgcatgttttaacagct
attttgagtaacttagccacgcaaagcttacaaacggccacttgtaaaattaatgcggct
gatttagtaaccgaatcaatgtccggggatgaggttggccaaagaattgctgatttaagt
gaattagcacaaattgatccgtatcgagcgacgacccataataagggaatcatgaatgga
attgatgctgttttgattgctacaggtaatgactggcgagcaattgagagtggcgcacat
gcctacgctgccattggtggtgtttataagggactgagtacttggcgctttgaaaagtcg
caattaattggttcaatcacgttgccgctgccagttggaattgttggcggttcgattgat
attgtgccgctggtcaaaataaatcagcgaataatgaaggttaactcggctcagcaatta
gctcaggttattgctagtgtgggattggctcaaaatttagcagcattaagagcattggca
acgaatgggattcaggttggtcatatgaaattgcaatatcgttcgttagcactttcggtg
ggtgccaagccagcagaaattgatgcgttggttgctcggctacaaaatgaacaacatgtc
gatcatcagtttgccatccaagaactagaacagttacgaaaggaattaaataatggcaga
aattaa

DBGET integrated database retrieval system