KEGG   Lactobacillus helveticus R0052: R0052_04450Help
Entry
R0052_04450       CDS       T02217                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00230  Purine metabolism
lhr01100  Metabolic pathways
Module
lhr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    R0052_04450 (gmk)
Enzymes [BR:lhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     R0052_04450 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA RsgA_GTPase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AFR21790
UniProt: J3ZDH4
Position
770775..771389
Genome map
AA seq 204 aa AA seqDB search
MADKGLLLVLSGPSGVGKGTVKSAIVENKVFPFEYSVSMTTRKPRPGEVDGKDYFFVSEE
RFQEAIRNGELLEYNNYVGHYYGTPLGPVKKMLHDGKDVLLEIDVNGAAKVREKMPDGVF
IFLTPPDLHTLHLRLEHRGTESEDVIRSRIRQVRNEILEMEEYDYAVVNDTVANAVDHIK
AIVDAEHVSVKRVVGDYRKMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggtttgttattagtactttctggtccttcaggtgttggtaagggaact
gtgaaaagtgctattgttgaaaacaaagtctttccgtttgagtattcagtttcgatgact
actcgtaagcctcgacctggagaagtcgatggtaaagattatttctttgtaagtgaagaa
cgttttcaagaagctattagaaatggtgagttattagaatataataattacgttggacat
tattatggtacgccattaggtcccgtaaaaaagatgttgcatgatggcaaggacgtttta
ttggagattgacgttaacggtgccgctaaggtccgtgaaaaaatgccagatggcgtgttc
atctttttaactccaccagatttgcatacattgcatttacgattagaacatcgtggtacc
gagtcagaagatgtaattcgtagtagaattaggcaagttcgaaatgaaatcttggaaatg
gaagagtatgattatgcagttgtaaatgatacagttgctaatgcagtagaccatatcaag
gcaattgttgatgcagagcatgtcagtgttaaacgtgtagttggtgactatcgcaagatg
gtcaaggaggattaa

DBGET integrated database retrieval system