KEGG   Lactobacillus helveticus R0052: R0052_08190Help
Entry
R0052_08190       CDS       T02217                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00010  Glycolysis / Gluconeogenesis
lhr00051  Fructose and mannose metabolism
lhr01100  Metabolic pathways
lhr01110  Biosynthesis of secondary metabolites
lhr01120  Microbial metabolism in diverse environments
lhr01130  Biosynthesis of antibiotics
lhr01200  Carbon metabolism
lhr01230  Biosynthesis of amino acids
Module
lhr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R0052_08190 (tpiA)
   00051 Fructose and mannose metabolism
    R0052_08190 (tpiA)
   00562 Inositol phosphate metabolism
    R0052_08190 (tpiA)
Enzymes [BR:lhr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     R0052_08190 (tpiA)
Exosome [BR:lhr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   R0052_08190 (tpiA)
  Exosomal proteins of bladder cancer cells
   R0052_08190 (tpiA)
  Exosomal proteins of melanoma cells
   R0052_08190 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF5105
Motif
Other DBs
NCBI-ProteinID: AFR22409
UniProt: J3XAP7
Position
complement(1439093..1439851)
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQKDWVVGQIKAALDGLTAEQVSNLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaagttacacatgaatccagaacaaact
actgaattcgttgacgctgttaaggacaagttgccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttaagaaaagcagctaagggctcaaactta
cacatcggtgctgaaaactgttactttgaagatgaaggtgcttacaccggtgaaacttca
cctaaggtcttgaaagaaatgggtatggactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggctaaggcaatctttgctaat
ggcttaaagccaattatttgctgtggtgaatcacttgaaacccgtgaagcaaacaagcaa
aaagactgggttgttggtcaaattaaggctgctttagatggtcttactgctgaacaagtt
tcaaaccttgttattgcttatgaaccaatctgggctattggtactggtaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgttaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaatgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system