KEGG   Lactobacillus helveticus R0052: R0052_08660Help
Entry
R0052_08660       CDS       T02217                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00071  Fatty acid degradation
lhr00072  Synthesis and degradation of ketone bodies
lhr00280  Valine, leucine and isoleucine degradation
lhr00310  Lysine degradation
lhr00362  Benzoate degradation
lhr00620  Pyruvate metabolism
lhr00630  Glyoxylate and dicarboxylate metabolism
lhr00640  Propanoate metabolism
lhr00650  Butanoate metabolism
lhr00900  Terpenoid backbone biosynthesis
lhr01100  Metabolic pathways
lhr01110  Biosynthesis of secondary metabolites
lhr01120  Microbial metabolism in diverse environments
lhr01130  Biosynthesis of antibiotics
lhr01200  Carbon metabolism
lhr01212  Fatty acid metabolism
lhr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R0052_08660
   00630 Glyoxylate and dicarboxylate metabolism
    R0052_08660
   00640 Propanoate metabolism
    R0052_08660
   00650 Butanoate metabolism
    R0052_08660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    R0052_08660
   00072 Synthesis and degradation of ketone bodies
    R0052_08660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R0052_08660
   00310 Lysine degradation
    R0052_08660
   00380 Tryptophan metabolism
    R0052_08660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R0052_08660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R0052_08660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    R0052_08660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhr04147]
    R0052_08660
Enzymes [BR:lhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R0052_08660
Exosome [BR:lhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R0052_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFR22486
Position
complement(1533904..1535064)
Genome map
AA seq 386 aa AA seqDB search
MKNIYIVAAKRTPFGKYRGFFKDASAIDLGVMALKGALKAGNIDPNDVQELFMGNVLSTG
LGENMARQVALNSGMRKESTAATINDVCGSSLKAVRLAQGQMELGDLDLVAVGGSESMTR
APYFVKKENKENPADHLVNTMINDGLMDAFSGQHMGITAENVAQRYHVSREEMDEFSLRS
HKKAAEATKSGFFDNEILPIEINGETLDHDEPIRPDTSMAALSQLKPVFKEDGDVTAGNS
SPLTDGASMLVLATEDKVKDLNLKPIAKLGGFAEAGFDPAYMGYTPYFAVKKLLKKTGRS
INDYDIVELNEAFASQSVAVARDLQIPDDRLNIMGGAIALGHPLGATGTRLICSAISGLK
KEQGQRALVTLCIGGGQAIAYEIENI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttatattgtagcggccaagagaacaccttttggcaagtatcgtggattt
tttaaagatgcttcggcaatcgatcttggtgtaatggcgttaaagggagctttaaaagca
ggaaatattgatcctaatgatgttcaagaacttttcatgggaaatgtgttgagtacaggc
ttaggtgaaaatatggcccgacaggttgctcttaactcggggatgagaaaagaatcaact
gcggcaacgattaatgacgtttgtggttcaagtcttaaggctgttcgtctggctcaaggt
caaatggaactaggcgaccttgatttagttgcagttggtggtagtgaaagcatgactcgt
gcgccatattttgttaaaaaagagaataaagaaaatcctgcagatcatttagtaaatact
atgattaatgatggtttgatggatgctttttctggacaacatatggggattaccgctgaa
aacgttgctcaaagatatcatgttagtcgtgaagaaatggatgaatttagtcttcgttct
cataaaaaagcggcagaggcaacaaaatccggcttttttgataatgaaattttgccaatt
gaaattaatggtgagactttagatcatgatgaaccaattcgtcctgacacttctatggca
gcattaagccaattaaaacctgtctttaaagaagatggtgatgtgacagctggcaattcc
tcaccgttaacagatggagctagtatgttggtattagccacagaagacaaggttaaagat
ttgaacttaaagccaatcgctaagctggggggctttgcggaggctggatttgatcctgct
tatatgggatatacgccatattttgctgtgaaaaaattgcttaaaaagacaggacgttca
attaatgattatgatatcgtggaactaaacgaagcttttgcttcacagagtgtagcagta
gcacgtgatttgcaaattcctgatgatagattgaatatcatgggcggtgctattgcatta
ggacatccgttaggtgctactggaactagattgatttgttctgcaattagtggcttgaag
aaagagcaaggtcaacgtgcattagtaaccttgtgcattggcggtggccaagcaatcgca
tatgaaatcgaaaatatctaa

DBGET integrated database retrieval system