KEGG   Linepithema humile (Argentine ant): 105670417Help
Entry
105670417         CDS       T04898                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lhu01001]
    105670417
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lhu04131]
    105670417
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lhu04812]
    105670417
   04147 Exosome [BR:lhu04147]
    105670417
Enzymes [BR:lhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105670417
Protein kinases [BR:lhu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105670417
Membrane trafficking [BR:lhu04131]
 Others
  Actin-binding proteins
   Others
    105670417
Cytoskeleton proteins [BR:lhu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105670417
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105670417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig C2-set_2 V-set Spectrin
Motif
Other DBs
NCBI-GeneID: 105670417
NCBI-ProteinID: XP_012219360
Position
Unknown
AA seq 4896 aa AA seqDB search
MPIQNLKAEDILEALESKLAYVPGGRDRDGRPLIVISVPSELDPTTKPKLESLILYFISI
FSEETKENGLVLIVDARRGAWRIARSCIRLSTNLIGSKVVSVIVVRPDGFWDKRVDSCTK
SHKEIEPIYVTQTRLHVYIDFSQLPYELAGNKAYNHVEWIKKRMKIEDYSRDALELISKM
TNLHQRLNTLDGIRMTQSDDDIESYWEIGTELLSTARQILQSGRSLVSSMSRESSKDTLD
TIKKIHKLLDSIELKQMDIENSWTEMERNFDTARVIEDLEQGVSSVTDWILGPADTMLNS
CCQVGFDVSSSEELRRQHEKLELQCRETYGRYAELLHKIDSLPNSSLPEDLKSQRDFMDF
VCRSFASRLERRRNVLITSQRFFRLVSEYFDRTSEVFEQLVMGSRNYNFSQASVKLLTLE
KSQTVLDSLERELVKEGEKLSDVLSMPVKDALGREVCVNYNEDIINVKDILDATNARKNI
FNDSVEIQKLSLKQIALIHMYESDAEQAVKWLDDLFNVLLENHMEVGCNAKEIQSQKEEH
QSFQETAKGTYEYGGQLVNGARVLRLSCRISLECNASLFSRLRQAWRQFRSVSQEQLTRL
RVCAVFHRNVEDHCTRLQNLVETVTALHHVAKDEDLTKSRIKADIRDILDNREKLLLEVG
RMVRLGRLLKTRLKEPLCHQQMSEAEDASILGSNLTAVEAISAKLAEVTRLAEKLDARLC
EAGARTRPVSIPTAVTSSSSSLLSISAMSSSNTPTRTISTATAPASDVTVASVIAQMHPV
SSETTSASATTSVDKSIIATAETPDESSLHIRSHSMEDVERLNKDAKELTENARSESAAE
EYNVEGYITATECSTTPPLRSRSESFVTMPECEDFSTATPVTSSCSDSTWLATETSKLIT
TTTPHISTPSNENPLKFAETTASTISTVNEIKPTTRIERMDKITDERSGRIVKEVTETTV
LRVSHDIRLDVASYKCVSNTVQDHRQHVDVKDIQNMERVLLEESRDETNGVHHDLDLSIS
KESEKYIDKSAKTVQPDENVTTKLTKIREHTLNETSRSDLKEYEDVSMSSQDFLRRHEDS
GIEMSPIKKDDNLEGEDFLERARKSGEWLKLKILELQPELTKLGASVKEATELSNAHDQV
LLRLQNKQSPVEELLRQADQLIATQRPRAEVYTAMAETLGQAWRDVNQLLERRKEILDSN
VLFQCRATECKENMEALEMACNDTLLPIEIEAVRSFLTKIQDLRKDMLEALMGALQEGKA
LLDKLKELANEGTLDSRPDNVKDEAKHAVLRVERWLEELHDRRRLIEASFRSRKTQLEQC
LALALLATDLRDLEEILNDRMAALTASCDQLGDSTSSVELLLFELKKLQAEAKEFQDRAI
KITKSTERLVSSGHFAGEQATEQAYAILSVAADYINDLDQYNALLNRAMIFFDSARSAIT
KLDQLEIQLMTTDHPLYSARLARFHAQTVTTIEDVISKPLSEGYALLDATGRGAPGAEGV
KNTVEELENRKIRLTERCTAHKEESLEISRMLTTFLDKHDALRAWLTSVAEAFLQGHQDM
GSDLAMACDFRRVHCQLLTDLENKSEEVDHLELEILPIIERLDETQKYELRSKIKDLEDE
WTKTKIALVKRIELGTIYIQFHEIVEEFTNEIDSIDNELKKCEDALDEARIDELERRWKS
LEPFYKKLDNCAKAFLDETSNVDDPYLDISRACLCVQTLLEKFANRQLIVTESWEKWQTT
VEITRQRRIECERKIEESTKTLAWTSKFETTLYPVITVRSSKIIDILDNLKDVKPRVLPE
LNSARQELDTRIKNIQVFVEKGEAKTTEQISRRLVQMYEKINTVAKDYETLLESLISFFK
NLEEIEHKIDQAKQEATRVSGFSKSTAVDGALNELEILKTFIAESLLRVRTKSEEIIDNI
RMQEPPEPATQDIEKLKRAIDSVVIEFESFQRQTSDYLEKHRRLCIFKEDIEKINSDLHD
LNEQLKNIDGRIGDNLSTSKATLAAFEQFEQTITILEERIETFVRKTEETIVPLTPQITD
EILSLRNRWDHLRKRVRDTKKRMNLSIEYFTLLEEAKQWFREGSKLLVIVARKATTVKLP
EEATELLQEINAYIKPGEEQQEKRIEQLKQLSTIVFGTDRLPQFNEVVVENRQMLDSFEV
VSSELRTLSQNLQNAEDLRERLRIEKLEADKKLEAAKIEMAAAEAARVEAENARKLAEQL
AAETLDKAAIEAKKLKEEEARKIVPPVSHSVSAQTDETVVEETITSAVTTKEIHILQKME
VEKNVPVIQKEASPPRKLVSEEIHDESYVENVQTEKIVSLAPKFIIPLSDATVQEGKEFN
FECRLIGQPTPEVVWYKDGISILNNPDYLTTYVNDVCTLKIEETFAEDSAKYTCRAFNIV
DSAETSATLTVKETILEEQPSAPVFVKELQASTVREGSSHKLECTVEGNPLPTVQWYKND
TNIDNSPDYAITFNNGEAILKFDEVFLEDKALYTCKATNQWGQSSTTASLDVQPAQITTK
KPYFVVPLSNAMARAGQKVKLECEASGDPVPELIWSHDGKPIEETKYHKIQTDGARTSLI
ITEAFPKDAGCYTVIAKNKVGETTVSCTVSVKGRLLHETSESDLVVCSDTEPVVPKFHLS
LRDLKIQEGQSARLDCVIVGQPEPEVIWYHDEQPVKESSDFQLLFQGDRCSLVIHEAFLD
DAGTYKVVAINSGGEASSQCTLTVMPASTIPDVIDRKKEDETLVSGSAPKFVRLPTDLLV
AEGEDAIFECAVTGEPKPDLKWYSDDGEVIHNERILIKEREDGTRFLKILSAIPEDKGNY
VAKAINVHGEAKAFARFKEVFEDRRIPEGISTKFECIVTGKPSPKIQWLFNDRPVHGKDF
LVSVSGDRQVLTIPEVGDAHIGTISCVAENAAGRAVCSAKVEIDSGSVKQIAGEVKEVLE
LVPHSPADIMHPASSSDKHFSSEKTYHEGGGESHVLTKMSSTVTHSSTTSTKKEFLSSST
STLSQSGQEPTSVCTKATVQSSEQSTSENGAPPVVQSHKIEEYEKIIQDRPGEVRQEKTV
VVSEEAEGVKRDVKTNQIQKPTRKPIAPRFVSPITGMIVDQGTDVVLEGIIDGFPQPTIL
WSKNGQKLTSTDNMKISYAHNHVKLELKNVNIKDAGRYTCTVSNDVGSASSTADLVVKKT
VFPPVFGKRLKAQVVKKGDRVIMEVEITGIPDPTVNWYKNDVPINERPPELRIIQQGNCY
TLLIDKAKEEDGGKYMVRATNAGGEAQSIADVAIFEPKPDTMVEVHKTVVYENVQDKNVV
QSKEKREEASSAILTSEQAPTTAIQPSPFKSISTLASTIDTVQKIEGPEIKASKSETISS
IIESHETETKSEQKLHMKLEHKTPSIVESRTEQTIAVKEVDRDKRDIAEPLIKTDEKSTI
ENENIETSTIARKDALSFFESITKESETLPKGPKGMIKLTEDGQVQAAKVGKLTKSYERG
ATYQEVKKSEPRPSEFQATKKAVQDIFTKLEQGPPRGVENKLFDFPYESPSAEIKKTAIE
EKIISDLSISQLQFQTESSETLLESFNLVPEPPPEICYMPKPEEVKKKRPDVFVKAKQLQ
ESFEKTLSPIDAPIGGVKIFPTPSTPKIPEPVKPTEPIPAFTIPPPFELEKREVFEETCV
KKDAHEKKESEYFKEEKIEPSKYASILRSTSPIRPWSSSSDVETKSHVSTDLSEYRCYSA
ASSHQETLRSMSPKPSADALAMEKSWAKKCADSNRKSWPPQTETFGQKWNIPVDEYKSSA
KEFKQKVEETPQGGIKKTSTESSTSIEKRSWSSKEEFTEKIVEAPPKLGPIIYNAETIKV
DHTVTPIQEKALFEKYISECNVEKAETTQKFEEYSSKHWAEDKELKAPSLVRKIEPAAKT
SLVTSRRLPETEVDSIVLEPGSPPEIGYIPPPFVKETAILENAKVEQREEPPVLPPKDVR
ITPPPIPAKKPVKHSTPVPSRFVKGPFSHESDYESDFDSRPKAKWRPYESDNEEPHYRKV
QAPILKQPTRPRSTEPEPLPPSKFETPAQFSGPSLVTESSEKTTRKMAFKRHERESKQQQ
QQSSIPLKPGSPPIYVQQSVKNSAPKSPSVKKPESPKFKTKVFHQESGYMADTDEPFQQK
ASSTTTQKFIGKREGSSTTVHTESHTTCSESRTKSFESHSYESDRLRKEESSSFVSPSIC
STQPAPKFVQQQRSSFEKSYASSTSSGLRRFESVKETGHSIDQLYKKLEPAEKVLPASPS
PSKFVKGDFRESDYESDYDGRTPPYRTASSMKFTATDSGKPTEPSSHRKQHTVVATKPKT
VLLPGSPPEIAYAPPQPQQQFYEARTSAPFTNAVGTETKKTVRMDESTENTRRIVTVEQT
SRVIKFGDTNAAPVPKQQSAHYRVPTPKKFVQGQFRESDYESDVDSNKIRPKWTPANSDT
EDLCYRKVQPPTIKSPRSSSASVRQIPSPMEFDTGPPTTSLTQIRRENTDKKINFQRHQQ
HTTSEKTDSILQPGSPPEYGFISRGDVKKAADHIASHHMSDMTSSFKSKTEKFVSDIQSD
LRQSKPILKHPVDSRTTDSDEPRTYREESRLSEHGTKQIDPDTGLIYFKYDFGYEFGIVL
PGEGKKTVESSKKTIQGQRRASDIEVPIVHEFTEKKTNGFTKKDTFLNRQSKSGSKFGSS
KTVKWEPTSESEFSEAEDTRNLNKKQSSNGSIDSSMAPPSLVIPSSVSPSRWDHITPSPL
SLSPSLPSLSPRQSSVTGPPSNVDSAGSPWPTSNGVSSNKEVIQPYLDILPKKAPIFITP
LKDIAVVSGHPARFECIVQAEPQPNILWSKDRRIVENSASHEIHYRNGVCRLTILRAFSD
DAGTYACTATNSLGSTVTSANLEVSGNRRSLYAAFS
NT seq 14691 nt NT seq  +upstreamnt  +downstreamnt
atgcctatacaaaatttgaaggcagaagatatcctggaggctctagaatcgaagctcgca
tatgttccaggtggtcgtgatcgcgacggacgacctttgatagtaattagcgttccatcg
gaactcgacccaacaacgaaaccgaaactagagtccctcatcttatattttatatcaatt
tttagcgaagagacgaaagaaaacggtttggttttaattgtggacgcgcgtcgcggtgca
tggcgcatagctaggtcttgtatcaggctatccacaaatcttataggatctaaagtcgtt
tctgtgatcgtcgtacgacctgatggcttctgggataaacgtgtcgacagttgtaccaag
tcgcacaaagaaatcgaaccaatatacgttactcaaacaagactgcacgtttatattgat
ttttctcaattgccatacgagttagcaggtaacaaggcatacaatcatgtcgagtggatt
aagaaacgtatgaaaatagaagattattcgagagacgcgttggagcttatatcaaaaatg
acaaatttgcatcaaagattaaatactctcgatggtattcgtatgacacaatcggacgat
gacatagagtcttattgggagatcggcacagaattgttatcaactgcacgtcaaatactc
caatcaggcaggagtttagtgagttccatgagcagagagtcctccaaagatactttagat
actattaaaaaaattcataaactactcgattcaatcgagttaaaacagatggacattgaa
aattcgtggacggagatggaacgaaattttgatactgccagagtgatcgaagatctcgag
caaggtgtatcgagcgttaccgattggatcctgggtccggcggacacaatgttgaactct
tgttgtcaggttggtttcgacgtttcctcatccgaagaactccgaagacagcatgaaaaa
ctggagcttcaatgtcgggaaacctatggacgatacgcagaattacttcacaaaatcgat
agtctccctaatagcagtctaccggaagatttaaagtctcagagagatttcatggacttt
gtgtgccgcagtttcgcttcgcgacttgaaaggcgcagaaatgtattgatcacttcgcag
cgattcttcaggcttgtttctgagtatttcgacagaacaagcgaggtatttgaacagttg
gttatgggtagcagaaactacaatttctctcaagcgagcgttaaactcctaacattggaa
aaaagtcaaacagttttagatagtttagagcgggaactcgtaaaagaaggtgaaaaactg
tcggatgttctctctatgccagtgaaggatgcgcttggtcgagaagtttgtgtcaattat
aacgaggacatcatcaatgtgaaagatattttagatgcaacaaatgccagaaagaacata
tttaatgacagcgtagaaatacagaagctgtcactaaagcaaatagctttgatacatatg
tacgagagcgatgccgaacaagctgttaaatggctagacgatctattcaacgttctactg
gagaatcacatggaagttggctgtaatgcaaaagaaatacaatcgcaaaaggaagagcat
caatcctttcaggaaaccgcaaagggaacttatgagtatggtggtcagctggtgaatggc
gcgcgcgtactgagattatcttgcagaatatctttagagtgcaacgccagtcttttttca
agattgcgacaagcctggcggcagtttcgatctgttagtcaggaacaactaacaagattg
cgagtatgcgctgtcttccacagaaacgtcgaagatcactgtaccagattacaaaacctg
gttgaaactgtgacggctctacatcatgtcgcaaaagacgaagacttaacgaaatcacgt
atcaaggcagatataagagatatccttgacaatcgagagaaacttttattggaagttggt
cggatggtgagattgggccgccttctcaagacgagattgaaggaacctctttgtcatcaa
caaatgtccgaagccgaagatgcttcgatcctcggcagtaatctgacagcagtggaagct
atctcggcgaaattggcggaagttacgcgtcttgcggaaaagctggatgcaagactatgc
gaagctggagctcgaactcgaccagtgtctattcctaccgcggtgacgtcctcctcttcg
tccttgctctcgatatctgccatgtcgtcgtcaaacacgcccacccgtacaatttctact
gcgactgcaccggcgtcggatgtgacagtcgcgtctgtaattgctcaaatgcatccagtg
tcttcggaaacaaccagtgcgtctgccacaactagtgttgataagtccattattgctaca
gctgaaacacctgacgaaagttcgctccacatccgttcacattccatggaggatgttgaa
agattaaataaagatgccaaggaacttaccgaaaatgctcgtagcgaaagtgcagcagaa
gaatacaatgtagagggttatataactgcgactgagtgttcaactactccacctctgcgt
tccaggagcgaatctttcgttacaatgccggaatgcgaagatttttctaccgcgacacct
gtgacgtcttcgtgttctgattccacttggttggctaccgaaacgtctaaattaataact
acaactacacctcatatttctaccccgagcaacgaaaatccgctgaaatttgctgaaaca
acagccagtactatttctaccgtcaacgaaataaaaccaacgacgcgaattgaaaggatg
gacaaaatcactgacgagcgatcaggcagaattgtaaaagaagttacggaaacgactgtt
ttacgcgtgtcacacgatattcgattagatgtagcctcttacaagtgcgtgtcaaatacc
gtgcaagatcatcggcaacatgtcgatgtgaaagatattcaaaatatggagcgtgtgtta
ttagaggaatctcgtgacgaaacgaatggcgttcatcatgatcttgatctatcaatctcc
aaagaatctgaaaaatatatcgataaatctgcaaaaacagttcagccggatgaaaatgtc
acaacgaaactcacgaagatccgagaacacacgttgaatgaaacctcgcgttctgacttg
aaagaatatgaggacgtgtcgatgtcctcgcaagattttttacgacgtcacgaggatagt
ggtattgaaatgtcgccaataaagaaagatgacaatttggaaggcgaggattttctcgag
agagcgaggaagagcggcgaatggctaaagctgaaaatactcgagctacaaccagaacta
acgaaacttggtgcttccgtaaaagaagcgacggaactctcgaatgcgcacgatcaagta
ctacttcgattacagaataagcaaagtccggtggaggaattattacggcaagccgatcaa
ttaattgcgacccagagacctagagcggaagtatacacggccatggcagagacgttgggc
caggcttggcgcgatgtgaaccaacttttggaacgtcgtaaagagatactcgattccaac
gtattgttccaatgtcgagcgacagagtgcaaagagaatatggaggcgttggaaatggcg
tgtaacgacacattactgccgatcgagatcgaagcagtgagaagctttctaacgaagatc
caggatctacgcaaagatatgttagaagcgctgatgggtgcattgcaggaaggcaaggcg
ttgctggacaaactcaaggaattagcaaacgagggcactttagactctaggccagacaac
gtcaaagatgaggctaagcacgctgtgttacgagtcgaaagatggctggaggaacttcac
gacagaagacggctcatcgaggcgtctttccgtagtcggaaaactcagttggagcaatgt
ctcgctctcgcactgctcgcgactgatcttcgtgatctcgaagaaattctcaacgacagg
atggctgcgttaaccgccagttgcgatcaattgggagattctacatctagcgtggaattg
cttctctttgaattaaagaaattgcaagccgaagcaaaggagtttcaagacagagccatt
aagataactaaatcgaccgaacgattagtgtcatcgggacactttgctggcgaacaagcg
accgaacaggcgtacgcgattcttagcgtcgccgccgattacatcaacgacttggatcag
tataatgcgctattaaacagagcaatgatctttttcgattctgcacgatcggctatcaca
aaattggaccagttagaaattcaattaatgacaacggatcatcctctttattccgcgcgg
ctcgcacgttttcacgcgcaaactgtgactacaatagaagacgtaatttcaaaacctttg
tcggaaggatacgcattattggacgccacgggaagaggagcgcctggtgccgagggtgta
aaaaatactgtcgaagaactggaaaatcgcaagattcgtttgacagaacggtgtacggct
cacaaagaggaaagtctggaaatttcgaggatgcttaccacatttttggataagcacgac
gctttacgagcttggttgactagcgtcgccgaggcctttcttcaaggacatcaggacatg
ggcagcgatttggcaatggcatgcgatttccgtcgagtacattgtcaactgctgaccgac
ctggaaaataaaagtgaagaggtggatcatttagaattggaaattcttcccatcatagaa
cgcctggatgaaacacaaaaatacgaattgcgatcaaaaataaaagatcttgaggacgag
tggacgaaaacgaagatcgcgttggtaaaaagaatcgaattaggcacgatttatatacag
tttcacgaaattgtcgaagaatttactaatgaaatcgattctatcgataacgaattgaaa
aaatgtgaggatgcgttagatgaggccagaatcgacgagctggaaagaagatggaagtct
cttgaacctttttacaaaaaactcgataattgtgctaaagcgttcctcgatgaaacaagc
aatgttgatgatccttatctcgatatatcgcgagcttgcttgtgtgttcaaactctttta
gagaagtttgccaatcgacaattgattgtgacagaatcatgggaaaagtggcagactact
gtcgaaattacaagacagaggcgaattgagtgcgagcggaaaattgaagaaagcacgaag
acattagcgtggacttcgaaatttgagacaacgctgtatccagtgataacagttcgatcc
tctaaaataatcgatattctggataatttgaaagatgtaaaaccacgggttctacctgaa
ttaaacagcgctcgtcaagaattggacactagaatcaaaaacattcaagtgtttgtcgaa
aaaggtgaagctaaaacaactgagcagatctcaagaagacttgtacaaatgtacgaaaaa
ataaatacagttgccaaagattacgaaacactattggaatctttaatctccttctttaaa
aatctcgaagagattgaacataaaattgatcaagcaaagcaagaagccacacgtgtgtca
ggtttttcaaagtcaactgccgtagatggcgcattaaacgaactcgagatattgaaaaca
tttattgcggaatctttgctacgagtacgaacgaaatctgaagaaataatcgacaacatt
agaatgcaggagcctccagaaccagcgacgcaagacatcgagaaactgaaacgtgccatc
gactccgtggttattgagtttgaatcattccaaagacaaacatccgattatctcgagaaa
catcgacgactttgcatctttaaagaggacatcgagaaaatcaactcggatctacacgat
ttaaacgaacagttaaaaaatatagatggaagaatcggtgacaatttatcgacatcaaaa
gcgacattggctgcttttgaacaatttgaacaaactataacgatcctggaggaaagaatt
gagacgtttgtgagaaagactgaagagacgattgttccgttaacaccacaaataacggac
gagattttatctctgcgaaacagatgggatcatctgaggaaacgcgtgcgagataccaaa
aaacgaatgaatttaagtatcgagtatttcacgctcttggaggaagccaaacagtggttt
agagaaggcagtaaacttttggtgattgtcgcgcgtaaagctacaactgtgaaattgcct
gaagaagccaccgaattactgcaagaaattaatgcttatatcaaaccgggtgaagagcag
caggaaaagagaattgaacagctgaagcaattatcgacgatagttttcggtacagataga
cttccgcaattcaacgaagtggtggtagaaaatcggcaaatgctagattccttcgaagtc
gtttcttctgaattgcgcaccctgagccagaatttgcagaatgccgaggatcttcgggaa
agactgcgaattgagaagttagaagctgacaagaaactggaagctgctaaaatagaaatg
gccgcggcggaagctgccagagtggaagcggaaaatgcgaggaaacttgcggaacagctc
gcggccgagaccttggacaaggctgcaattgaggcgaaaaagttgaaagaggaggaggcg
cgaaaaatcgtccctcctgtttctcactccgtctctgcccagactgatgagaccgtagta
gaagaaacgattacttccgccgtgacgacgaaagagattcacatccttcagaagatggaa
gtcgagaaaaatgttccagtgattcaaaaagaggctagtccaccaagaaaacttgtatcc
gaggaaatacacgatgaatcctatgttgaaaacgtgcaaacagaaaaaattgtatcattg
gctccaaaattcataattcctttaagcgacgcgacggttcaagaaggcaaagaattcaat
ttcgaatgccgtttaatcggccagccgacgccagaagtagtctggtacaaagatggaata
tcgattttgaacaatcccgattatttaacgacttacgtaaacgacgtttgtactttgaaa
atagaagagacattcgctgaagactccgccaagtatacttgccgcgcgtttaatattgtt
gactctgccgaaacatcagccactctcactgtcaaagaaactatcttggaggaacaaccc
agcgctcccgttttcgtgaaagagttgcaggcttccaccgtgagggaaggatcctcacat
aaattagagtgtactgttgaaggaaatcctcttccaacggtgcagtggtacaaaaacgat
acaaacatcgacaattctccggactatgctatcacttttaacaatggggaagctattcta
aagtttgatgaagtctttttggaagacaaagctttatatacctgtaaagcaacgaatcaa
tggggacaatcgtctactactgcttctctcgatgtgcaacccgcgcaaattactacaaag
aaaccatattttgtggtgccgttgtcaaatgcgatggccagagcgggccaaaaagtaaaa
ctagaatgcgaagctagcggagatccagttcctgaattaatctggtctcacgatggaaag
ccgattgaggaaactaaatatcataagattcaaacggatggtgctcgaacaagcttgatt
attacggaagcttttccgaaggacgccggatgttatacagtaatcgccaaaaacaaagtc
ggagagactactgtatcttgcaccgtttcagtgaaaggacgcttgcttcacgaaaccagc
gaatccgatttggttgtttgcagcgacacggaaccagtagttccgaaatttcatttatct
ttgcgggatcttaaaatacaagaaggacaatcagctagactagattgcgtgattgtaggt
cagcctgaaccggaggtgatttggtatcacgacgagcagcccgtgaaagaatcgtcagac
ttccagctacttttccaaggtgatagatgttcactagttattcacgaagctttcctggat
gatgctggcacatataaagtagttgccattaattctggcggcgaagcttctagtcaatgt
acattaacagttatgccggcatctaccatcccggatgtaatcgatcgaaagaaggaagac
gaaactctcgttagtggttcagcaccgaaattcgttagacttccgacggatctgcttgtg
gctgagggtgaagatgcgatcttcgagtgtgccgtaactggagaaccgaaacctgatttg
aaatggtactcggacgacggcgaagtcattcataacgagagaattttaatcaaagaacga
gaggatggaacaagattcttgaaaattttatccgcgataccggaagataagggcaattac
gtagcaaaagctataaacgtgcatggtgaagcgaaagcttttgcgaggttcaaagaagta
tttgaggatagaagaatacccgaaggaatttcgacaaaattcgaatgcatcgtcactggt
aaaccttctcccaagattcagtggttgtttaatgatcggccggttcatggaaaagatttc
ttagtgtccgttagcggggatcggcaagttctgacaattcctgaggtcggggatgcgcac
atcggcactatttcttgtgtagcggaaaacgcggctggtagagcagtttgtagcgctaaa
gtggaaattgatagtggatcagtgaaacagattgcaggtgaagtcaaagaagtgctcgag
ttagttccacattctcctgcagatatcatgcatcctgcgagtagtagtgataaacacttc
tcaagcgagaagacgtatcatgaaggtggtggtgaaagtcatgtgctaaccaaaatgtca
tcgactgtcacgcattcctcaacaacgtctacgaaaaaggaattcttatcgtcctctact
tccactttatcgcaatccggacaagaacctaccagtgtttgcacaaaagcaactgtgcaa
agttcggaacagtcaacttctgaaaatggagcaccacctgtcgtacagtctcacaagatc
gaggagtatgagaaaatcatacaggatcgacctggcgaggtgcgacaagagaaaactgtt
gtagtgtctgaagaagcggaaggagtaaaacgcgatgtcaagacaaatcaaatacaaaag
ccaaccagaaaaccgatagcgcccaggttcgtctcgccgattacagggatgattgtcgat
caaggaacggatgtagttctcgaaggcattattgatggttttccacaaccaaccatcttg
tggtcgaagaatggtcaaaaactaacatcgacagataatatgaaaattagttacgctcat
aatcacgtaaaattggaactgaagaatgtcaatataaaagacgctggacgttatacctgt
acagtgagcaatgatgttggaagcgctagtagcacggctgatcttgttgtcaaaaagaca
gtatttcctccggtcttcggcaagcgcctcaaagctcaagtagtaaaaaaaggagatcgc
gttattatggaagtggaaattaccggtatacctgatcccacagttaattggtataaaaac
gacgtgccgatcaatgaacgaccaccagaattgaggattattcaacaaggaaattgttat
acattgctcatagataaagctaaagaagaagatggcggtaaatacatggtgcgagcgacg
aacgccggtggcgaggcgcagagcatcgcagatgttgcgattttcgaaccaaagcccgat
acgatggtggaagtgcataaaactgttgtctatgaaaacgttcaggataaaaatgttgtc
cagtccaaggaaaagagggaagaggcgtcatcagccattttgacgagcgaacaggcacca
acgacagcgatccagccaagtccgtttaaatcaatttcgactctggcatcgacaatcgat
accgtgcaaaagatcgaagggccagagataaaagctagtaaatcggagacgatatcatct
ataatcgaatcccacgaaaccgaaacgaagtcggagcagaagttgcatatgaagctggaa
cataaaactccgtccatcgtagagtctcgaaccgaacaaacgattgcggtaaaggaagtt
gaccgtgacaaaagagacattgcggagccgttgataaagacggatgagaaatcaacaatc
gagaatgaaaacatagagacgtctactatcgcgagaaaagacgcgttaagcttcttcgaa
tcgattacgaaggaaagtgagacactgccgaaagggccgaagggaatgattaaactgacg
gaagacgggcaagttcaagcagcaaaggttggaaaattaacgaagagttatgagcgaggg
gcaacttatcaagaagtaaagaaatcggaaccaagaccatcggagtttcaagcgacgaaa
aaagctgtccaggatattttcacgaagttggaacaaggaccgccgcgtggagtggagaat
aaactgttcgacttcccgtacgagagtccttcagcggaaataaaaaaaacggcaatagag
gaaaaaataatttctgatttgtctatttcgcaactacagtttcagacagagagctccgaa
acgttgctggaaagtttcaaccttgtaccagaaccaccccccgagatatgttacatgccg
aagccggaagaggtgaaaaaaaaacgacccgatgtgtttgtcaaggcgaaacagcttcag
gagtcctttgagaaaaccctgtccccgatagatgctccaatcggaggtgtcaaaatcttt
cctacgccgtccaccccgaaaataccggaacctgtcaaacctacggaacctattcccgca
tttacgataccgccgccgttcgaactcgaaaagagagaagtgtttgaggaaacgtgcgta
aagaaagacgcgcacgagaaaaaggaaagcgaatactttaaggaagaaaagatagaacca
tcgaagtacgcatcgatcttgagaagtacttctcccatcagaccgtggtcatcgtcatcg
gatgtggaaaccaagtcgcatgtgtctacagacctttcggaatacagatgttactcggct
gcatctagccaccaagaaactctgagatcaatgtcgccaaagccatctgcggacgcattg
gcgatggaaaaatcctgggcgaaaaagtgcgcggattcgaatcgaaagtcatggccaccg
cagactgaaacttttggtcagaagtggaatattcccgtcgacgaatacaagagctccgca
aaagagtttaaacagaaggtcgaagaaacaccgcaaggtggaataaagaaaactagcacg
gaatcttcgaccagtatagagaaacgatcgtggagcagcaaagaagagttcacggagaaa
atagtggaagcaccgccgaaacttggtccgataatttataacgccgaaacgatcaaagtc
gatcacacggtaactccaatacaagagaaagcattgtttgaaaaatatataagtgagtgc
aatgtagagaaagcagaaacaacgcagaaatttgaagaatatagctcgaaacactgggca
gaggacaaagaattaaaagcgcctagcttggtacgaaaaatcgagccagccgcgaaaacg
tcgctcgtaacgtcgcgtcgccttccggagacggaagtggactcaatcgttctcgaaccg
ggatcacctccggaaattggatatattccaccaccttttgtaaaagagacagctatattg
gaaaacgcaaaagtggaacagagggaagaaccgcccgtgcttccgccgaaagatgtgcgc
attacaccaccgcctattccggctaagaaacctgtgaagcattcaacgccagtaccatca
agatttgttaaaggtccgttcagccacgaaagtgattatgagtctgatttcgacagtcgt
ccgaaagcaaagtggagaccttacgagagtgacaatgaggaaccgcattacagaaaagtc
caggcgcccattttgaaacaaccgacgaggccgagatccaccgagcccgagccacttccg
ccttccaaattcgagactcctgcacagttttcagggccatcgctcgtcacagaatcttcc
gaaaagacaacaaggaagatggcgtttaaacggcacgagagagaatccaagcagcaacag
cagcaaagctcgattcctttaaaacccggttctccaccgatttacgtacaacagagtgtg
aaaaattctgcaccaaaatctccgtccgttaaaaaaccggaatccccgaaattcaaaaca
aaagtttttcatcaagaaagcggttacatggcggacaccgacgagcctttccagcagaaa
gcttcgtctacgacgacgcagaagtttattggaaaacgcgaaggttcctcgacgacggtt
cacacggagagtcatactacatgctcagaaagtagaacgaaatcttttgaaagccacagt
tacgaaagcgatcgtttgcgaaaggaagaatcgtcgtctttcgtctcgccatctatttgc
agtacacagccggctccgaaattcgttcaacaacaacgcagctcgttcgagaaaagctac
gcctcgtcgactagcagcggtctacgcagattcgagtccgtgaaggaaacggggcattcc
atagatcagttgtacaaaaaattggaaccagcggaaaaggttctgccagcctctccgagt
ccttcgaaatttgtgaagggcgacttccgcgagagcgactatgagagcgactacgatggc
agaacaccgccctaccgtacagccagctcaatgaaatttactgctactgattcagggaag
ccaacggagccgagttcacatcgcaagcaacatacagtggtcgcgacaaaaccgaaaaca
gttctcttgcccggctcaccgccggaaatcgcatacgcgccgccacaaccgcagcaacaa
ttttacgaggcacgcaccagcgcgccgtttaccaacgcggtgggcacagagacgaagaaa
actgtgaggatggacgaatcaacggagaatactagaagaatcgtcactgtcgagcaaacg
agtcgcgttatcaaattcggcgacactaatgccgcacctgtgccgaaacagcaaagtgcg
cattaccgcgtgccaacaccgaagaaatttgtgcaaggacaatttcgggagtccgattac
gagagcgacgtggattctaacaaaatccggccgaagtggactccagcgaacagtgacacg
gaagatctgtgttaccggaaagttcaaccacccacgataaaaagtccaagatcatcgagt
gcgtcagtgaggcaaatcccatcgccgatggaattcgacaccggtcctccgacgacgtcg
ttgacgcagatccgcagagaaaacacggataaaaagatcaacttccaaagacaccagcag
catacaacttctgaaaaaaccgacagcattctacagcctggatcgccgcccgaatacgga
tttatttcaaggggcgacgtaaaaaaagcagcggaccacatcgcgtcacatcatatgagt
gacatgacaagcagcttcaagtcgaaaactgaaaaatttgtaagcgatatccagtcagac
ttgagacagagtaagccgattctgaaacatcctgtcgactcgaggacgaccgatagcgac
gagccaagaacttatagagaagaatcgcgactctccgaacacggaacaaaacaaatcgat
ccggacactggactcatatacttcaaatatgactttggttacgaattcggtatcgttttg
cccggcgagggcaagaaaacggtcgaaagcagcaagaagaccattcaagggcagagacgc
gcgagcgatatagaagtgcctatagtccacgagtttaccgagaagaaaacgaatggcttt
acgaagaaagacacatttttgaatcggcagagcaagtcgggaagtaaattcggaagctcg
aagactgtcaaatgggaaccgacatcggagagcgagttttccgaagctgaagacacgagg
aatctcaataagaagcagtcgagtaacggaagtatagatagctcgatggctccaccaagt
ctagtcatacctagctccgtgtcaccgtctaggtgggatcacataacgcccagtccactt
tctctcagtccaagcctaccgagcctctctcccagacaaagtagcgtcactggaccacct
agcaatgtggactctgcaggttcgccgtggccaaccagcaatggtgtatcatcaaacaag
gaagtgattcagccttacctcgatatattaccgaaaaaagctcctattttcatcacgcca
ttgaaagatatcgcggtagtgagcggacatcccgctagattcgagtgcattgttcaggct
gaaccgcaacctaatattctttggtcgaaggaccgcaggattgtcgaaaactctgcgagc
cacgaaatccattacaggaacggtgtttgccgccttactatattgagagctttctccgac
gatgccgggacttacgcatgtacggcaacgaatagcctaggttccaccgtaacttctgcc
aacttggaagtgtcaggtaatagacgatctctatatgctgccttttcgtaa

DBGET integrated database retrieval system