KEGG   Linepithema humile (Argentine ant): 105671329Help
Entry
105671329         CDS       T04898                                 

Definition
(RefSeq) insulin-degrading enzyme-like
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lhu01002]
    105671329
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     105671329
Peptidases and inhibitors [BR:lhu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   105671329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 105671329
NCBI-ProteinID: XP_012220810
Position
Unknown
AA seq 1002 aa AA seqDB search
MFCKSNSHPKLEDISLSKMRKTFNDLSQSTIFGSHSYVNEWMKVISQIHNNIKKPETDDR
QYRVLRLANGLKICLISDPTTHQAAAALTIQFGYKQNHVEGFAHLYQHVLYASRPNNEFA
KYVMKNSGIIDSQTLDETTTYYFDIKAEMFKQALEQFAGLFKALPKEVTDEYLEELLLGR
MYDEDKETQQIVNYRLSKLFKWNIDSTHDMTKNKFGTIYTAYEKPILCVKDYLQLFFPVE
YGADIMSLCVVGKESLDDLSAMILKFFFPLLRRRLLKSYLWHEPSCELIHKIWCRDIAVN
ESRLYIMYSVGDLDKRMAVERYFVYLLTYRGEKTFASVLESKGWITCIEAISHPCGSYYN
FMNIGMKLTEEGLKHVDDIVALLFQYNNLLRKRITERWMYNEFKEIQELKFRYETRQSIM
NDVRDISRKMLYCIDKELHNILRVGFVPYVWNKSNLECKISQLLNPLPQKIRIFVIDKRT
KGHVQEDELTNIEPECSILYKAETISREMCTKWMKAHTELKLPARNEFIPTVAGLKPYSI
IETRPKFYPAAINAEPFARVWYKRCPEFEAPKVNTIIHFICPHVFAKVNILHTHFNFMFV
RLLKESLHDYVYAAALVDLKWEIYATANGIQIEINGFDNKQHVIIEKIIDRMINFKLDTD
MFKVAKERNTELSISQLKKFKEDQPYNQAEEYLLHMLIDRPMKKEIWQQYEKVTFETFDK
FISKLFSMVFVECLIHGNITPEEARNITELIEAKLSANAKRIPAKYLENMWLNERFFIVQ
EPEHLVFQAYNEHHLSSSTKVFYQIPKRDIRTDVLVQFIQKIMEERCYDWMSKNKLLDYY
MHCGMLTTKITQGLTFLIHGSHEHVHLKMNEKIDEFIADMAHYIEHLSTEDFLKKKDEFI
ASRCSKPKTMTELSKAIWNETITRNYNFTRIQDSIECIKNIMPQEVYNFYQEFINKKTPK
ISVHITSIYNDKMKKMLPYNPKEVTVIDSIECFQGMFSSLKK
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcaagtctaatagtcatccaaaattggaagatatatcgctaagtaaaatgcgt
aagacattcaatgatctatcgcagtcgacaatatttggttcacacagttatgtgaacgag
tggatgaaagtgatatcacagatacacaataacataaaaaaaccagaaactgacgacaga
cagtacagagttcttagactcgccaatggattaaaaatatgtttaataagcgatccgaca
actcatcaagccgccgctgcgttgaccatacagtttggttacaagcagaatcatgtagaa
gggtttgcccacttatatcaacatgtgctgtatgcttcacgtccaaacaatgagttcgca
aagtatgtaatgaagaattcaggcattatcgatagccaaacgcttgacgaaaccaccacg
tattacttcgatataaaggcggaaatgtttaagcaagccttagagcaatttgccggactt
ttcaaggcactgcccaaagaggtcactgacgagtacctcgaagagttattacttggcagg
atgtacgatgaagacaaggaaactcaacagattgtaaattacagattatcgaagctattt
aaatggaatatagactcgactcatgatatgacgaaaaataaattcggcactatatatacg
gcatatgaaaagccgatactctgcgttaaggattacttacagctattctttcccgtggag
tacggtgcggatattatgtcattgtgcgtcgtgggcaaagaaagcttagatgatctttct
gccatgatattgaaattcttcttcccgctactaaggaggcgtttattaaaatcttatcta
tggcatgaaccttcgtgtgaacttatacacaaaatatggtgccgtgatatcgcagtaaat
gaatcgagattatatataatgtactctgtgggtgatttggataaaagaatggcggttgag
cgttacttcgtttatttgctcacatacagaggcgagaaaacgtttgcgtcagttttagag
tcgaaaggttggatcacttgcatcgaagccataagccacccctgcggctcgtattacaat
ttcatgaatattggcatgaaattgactgaagaaggcttaaaacatgtcgatgatattgtc
gcattgttatttcaatataacaacttgctgagaaaaagaatcacggagagatggatgtac
aatgaatttaaagaaatccaagaactgaaattccgctatgaaacaaggcaatcaattatg
aatgatgttcgagacattagtcgaaaaatgttgtactgtatagacaaagagctacacaac
attcttcgcgtcggttttgtgccctacgtatggaataaaagtaatttggaatgtaaaata
tctcagttgttaaacccattaccacagaagattaggatttttgtaatcgataaaagaact
aaaggacatgtacaagaggacgagttgacgaatattgaacctgagtgctcaatactatac
aaagccgagaccatatcaagggaaatgtgtactaaatggatgaaggcacatacggagttg
aagttacctgccagaaacgagtttataccgacagtggctggtttgaagccatattcaatc
atcgagacacgaccaaagttctatcctgcagctataaatgctgagccttttgcgagagtt
tggtataaaagatgtcctgaattcgaagcaccaaaagttaacacgatcattcattttatc
tgtccacacgtctttgctaaagtaaatattcttcacacccattttaattttatgtttgtc
cggcttcttaaagaatctttgcatgattatgtatacgctgctgctttagttgacttaaaa
tgggaaatttatgctactgccaacggaattcaaattgaaataaatggtttcgataataag
caacatgtaataatagaaaaaatcatcgaccgaatgatcaatttcaagttagatacggat
atgttcaaagtcgctaaagaacgtaatacggagcttagcattagccagctcaagaaattc
aaggaagatcaaccatataatcaagcagaagagtatctcttacacatgttgatcgatagg
ccgatgaagaaggaaatatggcagcaatatgagaaagtaacttttgagacattcgacaag
ttcatatcgaagcttttctctatggtattcgtggagtgtttaatacacggtaacataact
cctgaagaagctagaaacattactgagttaatcgaggctaaactgagtgcaaatgcaaaa
cgaataccagccaagtatttagagaacatgtggctaaacgaacgttttttcatagttcaa
gaacctgaacatttagtatttcaagcttataatgagcaccacttgagttcaagtacaaaa
gtattctaccaaattcctaagcgagacataaggacagacgtgctcgtgcaattcatacaa
aaaataatggaagaacgttgttatgattggatgtcaaaaaacaaattattagattattac
atgcattgcgggatgcttacaacaaaaattacgcaaggcttgacattcttaattcatggt
tcacatgaacacgtgcatttaaaaatgaacgaaaaaatcgacgaatttatagccgacatg
gcgcattacatagaacacttaagcacagaggatttcttgaagaaaaaggatgaatttatt
gcatcacgttgttcaaaaccaaaaacaatgactgaactgtctaaagcaatttggaatgag
actataactaggaactataactttacgcgaatccaagactcaatagaatgcataaagaat
ataatgccgcaggaggtgtataacttttatcaggaattcataaataaaaagactcctaaa
atatcagtgcatataacatccatatataatgacaaaatgaagaaaatgctcccatacaat
ccaaaggaagttactgtgatcgatagcattgaatgctttcaaggtatgttttcgtcttta
aaaaaataa

DBGET integrated database retrieval system