KEGG   Linepithema humile (Argentine ant): 105674490Help
Entry
105674490         CDS       T04898                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00350  Tyrosine metabolism
lhu00360  Phenylalanine metabolism
lhu00380  Tryptophan metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105674490
   00360 Phenylalanine metabolism
    105674490
   00380 Tryptophan metabolism
    105674490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105674490
Enzymes [BR:lhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105674490
    4.1.1.105  L-tryptophan decarboxylase
     105674490
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105674490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 105674490
NCBI-ProteinID: XP_012226256
Position
Unknown
AA seq 510 aa AA seqDB search
MDTSEFVDFAKTMIDFVANYTDTLRDRNVLPNVEPGYLNKLLPEEAPQKAEKWQEVLNDV
ERYIMPGITHWNSPHFHAYFPTANSYPAAVAEILSNAIGCIGFNWIASPACTELEVIVCN
WLAKLLGLPNEFLHSKDGTGGGVIQGSASECTFMCLLVAKEHTTRRMKNLHPDMDEDLIK
SKLIAYTSDQSNCSVEKAGILGSMLMRLLPVDDKCSLRGETLKKAIEEDLEKGLIPCYVV
ATLGTTGTCAFDNLDEIGPICKKYNMWLHVDAAYAGAAFVCSEFRYLMSGVQYADSFNIN
AHKWLLVNFDASILWLKDSKPLVETFSVNRIYLAHNKEGMVPDYRNWQIPLGRRFRSLKL
WFVMRIYGAEGLQEHIKHTIRLAQFFEKYVRSDNRFEIVTEVTMGLVCFRIKGDNNLTKK
LLDRLHARKKIYLIAGMYQNKLVARFVICSRLCQKEDVTFAWNEISDQTTEILQEVYKES
IDKIAKSPDDIVTRIETLNLETKEISQKIS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcggaattcgtggactttgccaagacaatgattgattttgtcgcaaattat
actgacactttaagagacagaaatgtactgcccaatgtggagccgggttatctcaataaa
ttattaccagaagaggcgccacaaaaagctgagaaatggcaagaggtgcttaatgatgtg
gagcgatacattatgccaggaatcacacattggaattccccacattttcacgcatacttt
ccaacggctaattcttatccggctgccgtagccgaaattttaagtaatgcaattggttgt
attggttttaattggatagcatccccggcctgcactgaattagaggtcattgtgtgtaat
tggcttgccaaactgttgggtttgcctaacgagtttttgcatagcaaagatgggacaggt
ggaggagtaatacagggatctgcaagtgaatgtacgttcatgtgtttgctggttgcgaaa
gagcataccacgcgtcgaatgaaaaatcttcatccagatatggatgaggatctcattaag
tctaaattgattgcgtatacttccgatcaatccaattgttcagtggaaaaagccggaatt
ttaggatcaatgttaatgaggttgcttccagtggatgataagtgttctctgcgtggagaa
actttgaagaaagcgattgaagaagatttggagaaaggcctcattccatgttacgtcgtc
gctactttaggaactaccggtacttgcgctttcgataatcttgatgagataggacctata
tgcaaaaagtataacatgtggttgcatgtcgatgctgcttacgcaggtgcagcatttgtt
tgttcggagtttcgttatttaatgtccggagtacaatatgcagactctttcaatataaat
gcacacaagtggttgctggttaattttgatgcttcgatattgtggctaaaagactcgaaa
ccactcgtagaaacgttctctgttaacagaatatatcttgcccacaataaagaaggaatg
gtgcccgattatagaaattggcaaattcctctgggtcggcgttttcgctcattaaaatta
tggtttgtcatgcgcatttatggagcggagggacttcaagaacacatcaaacataccata
agactagcgcaattctttgaaaagtatgttagatcggataatagattcgaaatagtgacc
gaagttactatgggtcttgtctgttttcgtatcaagggcgataacaatttaacaaaaaag
ttgttagatcgtctgcacgctagaaaaaagatctatctcattgccggcatgtatcagaac
aaacttgtcgccagatttgtcatctgcagtcgactatgtcagaaagaagacgttactttt
gcatggaatgaaataagtgatcaaacaacagaaattttgcaagaagtttacaaagaatca
attgacaaaatcgcaaagtcaccggacgatattgtgacgagaatagaaactttgaatctg
gaaacaaaggaaatttcgcaaaaaatatcttaa

DBGET integrated database retrieval system