KEGG   Linepithema humile (Argentine ant): 105674573Help
Entry
105674573         CDS       T04898                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105674573
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lhu03012]
    105674573
Translation factors [BR:lhu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    105674573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI OSCP
Motif
Other DBs
NCBI-GeneID: 105674573
NCBI-ProteinID: XP_012226415
Position
Unknown
AA seq 895 aa AA seqDB search
MSRFFATGSDSESDSASEEEQIQRAPTTAFTFSDDEEETKRVVRSTKEKRYEEIANLIKL
IRNYKKIKDMSSMLTSFEDLMRAYQKALPVITKEELGQTPRFYVRCLVEMEDFINEVWED
RDGRKNMSKNNSKSLSTLRQKLRKYNKDFEEDIGKFRENPDQDDDDEEEKAEEVIESEEE
EDSAVAFKKAGSEASEPDVAKFKKGATDGEEGSESEQSDWGSDSDSESTSSDDEGQYQNI
RERFIKKALAQEGGDDEDKAKRKEQRKERKEKERKKKRDEDDGEGEWETVKGGVAIPSEK
PKMFAKDAEINITAVLKKLSEIIAARGKKRTDRREQIELLHELQSIADAHTLGPAVTVKI
KFSIVSSIFDYNPKVSDAMKPEYWSKILERITEMLDMLLNNTDMVIAETIAEDMEEFETA
PFKIHGCVLTLVERLDEEFIKLLKECDPHSNEYVERLKDEKQVAAIIDKVQEYLERQGTV
SELCRVYLRKIEHLYYKFDPNVLKQKEGELGKEAITSVQVMEKLCKYVYAHDNTDRLRTR
AILSHIYHHALHDNWFQARDLILMSHLQETIQHSDPATQILYNRTIAHLGLCAFRHANIK
DAHNCLVDLMVTGKVKELLAQGLLPQRQHERSKEQEKIEKQRQMPFHMHINLELLECVYL
VSAMLIEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRNG
NWSACNNFIINEKMNAKVWDLFYQADKVRAMLTRLIKEEALRTYLFTYSHVYDSISMPKL
ADMFQLKRPVVHSIISKMIINEELMASLDDPTGTVVMHRSEPSRLQSLALQLTDKVNNFV
DSNERIFEMKQGNFFSRGNQGNFRDRQNYNRQGQDWGRQRRDRDRDRNREENRNY
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtttctttgcgactggctcagattctgagtctgatagcgcatctgaggaggag
caaatacaaagggcgccaacaacagcttttactttcagtgatgacgaggaagaaacaaag
cgtgttgtacgctccacaaaagagaaaagatatgaggagattgccaatcttataaaactt
atcaggaattataagaaaattaaggatatgagtagcatgctgacgagttttgaggatttg
atgcgagcttatcaaaaagctttgccagtaatcactaaggaggaacttggacaaactcca
cgattttatgttaggtgtttagtggaaatggaagattttattaacgaagtatgggaagat
cgtgatggacgcaagaatatgtctaagaataattccaaatcactttcaacattacgtcaa
aaattacgtaaatataataaggattttgaagaggacataggcaaattcagggagaaccct
gatcaagatgatgatgatgaagaagaaaaagctgaggaagttatagagtctgaggaagaa
gaagacagcgctgtggcttttaaaaaggcaggatcagaagctagtgaacctgatgttgca
aagttcaagaaaggtgcaactgatggcgaggagggcagcgaaagcgagcaatctgattgg
ggcagtgattcggacagcgagagcacaagtagcgacgatgaaggccaatatcaaaatatt
cgtgaacgtttcatcaaaaaggctttagcccaggaagggggggacgatgaggataaagcg
aagaggaaggaacagcgtaaggaacgcaaagagaaggagcgaaagaagaagcgcgacgaa
gacgatggcgaaggagaatgggaaactgtgaagggtggcgtggctattccttccgagaag
ccgaagatgtttgccaaggacgcagagatcaacatcactgcggtgctgaagaaactttct
gagataattgcagctcgcggtaaaaaacgtacagacagacgagagcaaatcgagctcctg
cacgagttgcaatcgatagctgacgcacacactctcggcccggctgtgactgtgaaaatt
aagttttctatcgtgtcttccatattcgattacaatccgaaggtttccgacgccatgaag
cctgaatattggtccaaaatattagagcgcattaccgagatgctcgacatgctgttgaac
aacacagatatggtgatcgcggaaacgatcgcggaagacatggaggagttcgaaacggcg
ccgttcaaaatacatggctgcgtgttaacgttagtggagcgtctcgatgaagaatttata
aaattgctgaaggaatgcgatccgcacagcaacgaatacgtagaaagattgaaggatgag
aaacaagtcgctgccataatagataaggtacaagagtatttggagaggcaaggaactgtg
tccgaactttgtcgcgtgtacctgcgcaaaatcgagcatttgtattacaaattcgatcca
aatgttctgaagcaaaaagagggcgagctgggaaaagaggcaatcacatccgtacaagtc
atggaaaagctctgcaaatacgtttatgctcacgacaacactgatcgattgagaactcgc
gcgattctgtcgcacatttatcaccacgcacttcacgataattggttccaagcccgtgac
ttgattctaatgtcgcatctccaggaaaccattcagcattctgatccagctacacagatt
ttatacaatcgtacgatcgctcatctaggactatgcgcattccgtcatgcaaatattaaa
gatgcccacaactgcttagtcgatttaatggtgacaggcaaagtaaaggaacttttggcg
caaggtctgcttcctcaacgacagcacgagcgcagcaaagaacaggagaagattgaaaag
caaaggcaaatgcctttccacatgcacatcaatctggaactccttgaatgcgtatatctc
gtctcagcaatgcttatcgagattccatacatggctgcgcacgagtttgacgcaaggcga
aggatgatttcgaagacgttctatcagcagttgcgatccagcgagcgtcaatcgttagtg
ggaccaccggaatccatgagggagcatgtcgttgctgctgccaaagcaatgcgcaatgga
aattggtctgcttgcaacaatttcattatcaatgaaaagatgaacgcaaaggtctgggat
ctcttctatcaggcggacaaagtacgagctatgctaacgcgattaattaaggaggaagcg
ttgcggacttatttattcacgtactcgcatgtctacgattcgatctccatgccaaaactc
gctgacatgttccagttaaagcgacctgtggtccactctattatcagcaaaatgattatt
aacgaagaacttatggcatccttggacgatccgacaggaaccgtcgtcatgcatcgcagc
gaaccgagccgccttcaatccttagccctgcaactcaccgataaagtaaacaactttgtt
gattcgaacgaacgtatcttcgagatgaagcaaggtaatttcttctcgaggggaaaccaa
ggcaacttccgcgaccgtcagaattacaatcgccagggacaggattggggtcggcaaagg
cgcgatcgcgaccgcgatcgtaatcgggaggagaatcgaaattattaa

DBGET integrated database retrieval system