KEGG   Linepithema humile (Argentine ant): 105675200Help
Entry
105675200         CDS       T04898                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00051  Fructose and mannose metabolism
lhu00520  Amino sugar and nucleotide sugar metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105675200
   00520 Amino sugar and nucleotide sugar metabolism
    105675200
Enzymes [BR:lhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     105675200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 IspD
Motif
Other DBs
NCBI-GeneID: 105675200
NCBI-ProteinID: XP_012227602
Position
Unknown
AA seq 369 aa AA seqDB search
MHEKRKKLQTMRAVILVGGYGTRLRPLTLSRPKPLVEFANKPILLHQIEALVQTNVTEVI
LAVSYRAQQMEEELVHEAKKLGIRLIFSHEPEPLGTAGPLALAREYLCDSDDPFFVLNSD
IICDFPFKQLLEFHENHGKEGTIVVTKVEEPSKYGVVVYKEDGKIESFIEKPQEFISNKI
NAGMYILNPSVLNRIELKPTSIEKEVFPNMAQDGELYAMELPGFWMDVGQPKDFLTGMSM
YLASLRQRHPEQLHSGPGIVGNVLIDPTATIGKDCRIGPNVTIGPGVTLSDGCCIKRSTI
LKAAVVKEHAWLDGCIVGWRSVVGRWVRMENTTVLGEDVIVKDEIYINGGQVLPHKSIST
SVPEPQIIM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaagagaaaaaaattacaaaccatgcgtgctgtaatacttgtgggtggctat
ggaaccagattacgaccccttactttaagccggcctaaaccgcttgttgaatttgcaaat
aaaccaatacttctacatcagattgaggcactggtacaaacaaatgtaacggaagtaata
ttagctgtctcgtatcgagcgcagcagatggaggaggagttggttcacgaagcgaaaaaa
ttaggaatacgactcattttctctcacgaaccggagccattgggtactgctggaccactt
gcacttgcccgcgaatacttatgtgacagtgatgatcctttttttgttttgaactccgat
atcatttgcgattttccctttaaacagttgcttgaattccacgagaatcatggtaaagaa
ggaaccatagttgtcactaaagtggaggaaccatcgaagtatggtgtggttgtgtacaag
gaagatggaaaaattgagagctttattgaaaaaccacaagaatttatatcgaataaaatt
aacgcaggtatgtacattcttaatccgagcgtattgaacagaatagaattgaagcctacg
agcatcgagaaggaagtctttccaaatatggctcaggatggagaattatatgctatggaa
ttgccaggcttctggatggatgtggggcaacctaaagacttcctcacaggtatgtctatg
tatcttgcttcactaaggcaaaggcatcctgagcaacttcattctgggcctggtatagta
ggcaatgtcttgatagatccaacggctacaattggtaaagattgccgaattggacccaac
gtcacaatcgggcccggtgtcactttatccgatggatgttgtattaaacggagtactatt
cttaaagcagctgtggtcaaagagcatgcatggctcgacgggtgtatcgttgggtggaga
agcgtcgtaggacgatgggtgcgaatggaaaatacaactgtattaggagaagatgttatc
gtgaaggatgaaatatatatcaatggcggacaagttttgccgcataaaagtatttccact
tctgtaccggaaccgcagatcatcatgtga

DBGET integrated database retrieval system