KEGG   Linepithema humile (Argentine ant): 105675460Help
Entry
105675460         CDS       T04898                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu03040  Spliceosome
lhu04141  Protein processing in endoplasmic reticulum
lhu04144  Endocytosis
lhu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105675460
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105675460
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105675460
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105675460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lhu01009]
    105675460
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lhu03041]
    105675460
   03009 Ribosome biogenesis [BR:lhu03009]
    105675460
   03110 Chaperones and folding catalysts [BR:lhu03110]
    105675460
   04131 Membrane trafficking [BR:lhu04131]
    105675460
   03051 Proteasome [BR:lhu03051]
    105675460
   03029 Mitochondrial biogenesis [BR:lhu03029]
    105675460
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105675460
Protein phosphatases and associated proteins [BR:lhu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105675460
Spliceosome [BR:lhu03041]
 Complex B
  Other components
   Prp19 complex
    105675460
 Complex C
   Prp19-CDC5 complex
    105675460
Ribosome biogenesis [BR:lhu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105675460
Chaperones and folding catalysts [BR:lhu03110]
 Heat shock proteins
  HSP70 / DNAK
   105675460
Membrane trafficking [BR:lhu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105675460
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105675460
Proteasome [BR:lhu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105675460
Mitochondrial biogenesis [BR:lhu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105675460
Exosome [BR:lhu04147]
 Exosomal proteins
  Proteins found in most exosomes
   105675460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A HORMA
Motif
Other DBs
NCBI-GeneID: 105675460
NCBI-ProteinID: XP_012228066
Position
Unknown
AA seq 649 aa AA seqDB search
MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPSNTIFDAKRLIGRRFEDATVQSDMKHWPFTVINEGGKPKISVSYKGETKTFFPEEVS
SMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
IAYGLDKKTSGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLSTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRA
RFEELCADMFRSTLEPVEKALRDAKMDKAQVHSIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAIEKSTGKENKITITNDKGRLSKEDIERMVDEAEQYRSEDEQQRERISAKN
ALESYCFNMKSTMEDDKIKDKIDASDKEKITSKCNEVISWLDANQLAEKDEFNDKQKELE
AICNPIVTKLYQSGGGVPGGFPGAAAGGAGPNPGAGGAGGAGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagcaccagcggttggaattgacttgggcaccacgtactcttgcgtgggtgtt
tttcaacacgggaaggttgagatcattgctaatgatcagggcaatcggactacaccgagc
tatgtggctttcaccgataccgagagattgatcggcgatgcggcgaaaaaccaggttgcc
atgaatcctagcaataccatcttcgacgcaaagcgtttgatcggtcgccggttcgaagat
gcgacggtacaaagcgacatgaagcattggccgtttacggtgatcaatgaaggaggcaaa
ccgaaaatcagcgtgtcttacaaaggcgagacgaagactttcttccccgaagaggtgtcc
tctatggttttgacgaagatgaaggaaacggcggaagcatatctgggcaagactgttacg
aacgccgtcatcactgtaccagcttatttcaatgattctcagaggcaagcgacgaaggac
gccggcgctatcgccggtttgaatgttctcaggataataaacgagccgacggcagctgcg
atagcgtacggtctcgataagaaaacttcaggcgagaagaacgtcctgatcttcgacttg
ggtggaggtacctttgatgtgtcgatcctgacaattgaagacggcatctttgaggtgaaa
tctacggccggcgacacgcatctcggcggagaggactttgacaatcgaatggtgaatcac
tttgtgcaagaattcaagaggaagtacaaaaaggacttgagcaccaacaagagagccctg
agacgcctgaggacggcctgcgagagggcgaaaagaacattgagctcgtcgacgcaggcg
agcattgagattgactcgctgttcgagggtatcgacttctacacgtccatcactagggcc
agatttgaggaactctgcgccgatatgttcagaagcaccctcgaacctgtggagaaagcg
ctgagggacgcgaagatggacaaggcacaagtacacagcatagttctagtcggtggctct
accaggataccaaagattcagaagctgcttcaagatttcttcaacggcaaggaactgaat
aaatccatcaatccggacgaggctgttgcctacggcgcagcggttcaggcagctattctg
cacggcgacaagtctgaagaggttcaagatctgcttctgctggacgtgactccgctgtcg
ctgggcattgagacggctggcggtgtcatgaccactttgatcaagaggaacaccacgata
cccacgaagcagacgcagacgtttaccacgtattccgacaatcagccgggagtacttatt
caagtctacgagggagagagagcgatgaccaaggacaacaacatccttggtaaatttgag
ctgacgggaataccacctgcgcctaggggcgtaccgcaaattgaagttaccttcgacatc
gacgccaatggtatattgaatgtctctgcgattgaaaaatccacgggcaaagaaaataag
attacgattaccaatgacaagggtcgtttgtcgaaggaggacatagagaggatggtggac
gaagccgagcaataccgatcggaggatgaacaacagcgagagaggatttccgccaagaac
gctctcgaatcgtactgcttcaacatgaagagcacgatggaggatgataagattaaggat
aaaatcgacgcgtctgacaaagagaaaattacctccaagtgcaacgaggtcatctcatgg
ttggacgccaatcaattagcggagaaagacgaattcaatgacaagcagaaagaactagag
gccatttgcaatcctatcgtgacaaaactctatcaaagtggtggtggagtacctggtggc
ttccctggtgcagcagctggtggagcaggacctaatcctggtgccggtggcgccggaggc
gccggaccaactatcgaagaagtcgattaa

DBGET integrated database retrieval system