KEGG   Linepithema humile (Argentine ant): 105676062Help
Entry
105676062         CDS       T04898                                 

Definition
(RefSeq) protein henna isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00360  Phenylalanine metabolism
lhu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lhu00790  Folate biosynthesis
lhu01100  Metabolic pathways
lhu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    105676062
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    105676062
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105676062
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     105676062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT DUF5312
Motif
Other DBs
NCBI-GeneID: 105676062
NCBI-ProteinID: XP_012229076
Position
Unknown
AA seq 466 aa AA seqDB search
MYAQISRKTPDIEEESESLLSSSPLDTPKLIHGGNYIKEGRDSARSTCLIFSPKEEDEIG
SLGRYLQLFAKHKVNLLHIESRSSLRRPGGYEFMVECAPGGNIASAIESLREQCNYFSII
SRNHKDNMDTVPWFPRRIRDLDKFANQILSYGAELDSDHPGFTDPVYRKRRKYFADIAYH
YKYGQVIPRVKYTPEEIATWGVVFKNLTKLYPKYACKEHNHVFPLLIENCGYREDNIPQL
EDISNFLKDSTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPLYTPEPDVCHEI
LGHVPLLADPSFAQFSQVIGLASLGAPDDYIEKLATCFWFTVEYGLCRQNGELKAYGAGL
LSSFGELEYCLSDKPELRPFDPPKTALQKYPITEYQPVYYVAEDFEDAKEKMMKFAQTIP
RKFGVRYDAYTQSISIIDSKQQVETLVNNVNQEVQILMDALKKLQH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgcaaataagccgaaaaacgccagatatcgaagaggaaagcgaatcacttctt
agcagttctcctttagatacgccaaaacttattcatggcggaaattatatcaaagaaggt
cgggattcagctagaagcacttgcttaattttttctcctaaagaagaagatgaaattgga
tcattgggaagatatctccaactcttcgccaaacacaaagtgaatcttttacatatcgag
tccagaagttctctacgacgaccaggcggctatgaatttatggtggaatgtgcaccgggt
ggtaatatagcctccgcaattgaatccctacgagagcaatgcaactatttttcgataatc
tctagaaatcataaagacaatatggatacagtaccatggtttccaagaaggatacgcgac
ctcgataagtttgctaatcaaattttgtcctatggtgcagaactcgatagcgatcatcct
ggtttcacagatcccgtttatagaaagagaaggaaatatttcgctgacattgcttaccac
tataaatacggacaagttattccaagagtgaaatacacgcctgaagaaatagctacatgg
ggcgtagtcttcaaaaatttgactaaactttatccaaagtacgcttgtaaggagcataat
cacgtttttcccttgctcatcgaaaattgcggttatcgggaagataatataccccaactc
gaagatatatccaactttttgaaggattctaccggtttcacacttcgtccagtggcaggg
ctactgtcttcacgcgattttctggctggtttagcatttagagtgtttcacagtacgcaa
tatatacgacacagcagtaaaccactttatacgcccgaaccggatgtatgtcatgagatt
ttaggccatgtgcctctcctcgctgatccatcttttgcacaattttcacaagttattggt
ctggcgtctctcggtgctccagatgattacatagaaaaacttgcaacgtgtttctggttt
acggtggaatacggattatgtcgacagaacggcgaattaaaagcgtatggcgccggtctt
ctctcatcatttggagaattggaatattgtttaagcgacaaaccagaacttcgacctttt
gatccaccaaagactgcattgcaaaaatatccgataacggaatatcaacccgtatattat
gttgctgaagattttgaggacgcaaaagaaaaaatgatgaaatttgcccaaaccataccg
aggaaattcggagtaaggtatgacgcttatacacagagtatcagcattattgacagtaaa
caacaagtggaaactcttgtgaataatgtgaatcaagaagtacagattttgatggacgct
ttgaaaaaactgcaacattag

DBGET integrated database retrieval system