KEGG   Linepithema humile (Argentine ant): 105676177Help
Entry
105676177         CDS       T04898                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lhu01002]
    105676177
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105676177
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105676177
Peptidases [BR:lhu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105676177
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105676177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 105676177
NCBI-ProteinID: XP_012229308
Position
Unknown
AA seq 364 aa AA seqDB search
MKLNDPLVIAAALVPFVILEIWYIGINLVWSMKASALLYLVLFGLLPVIFHYSYTIQRKI
LFLNFVQWPIKIEFSNPKLMGLEGARNFYLHTDQQVKIGVWQILPRSLLNNSIPATDEAY
EAVLNNAKRPVFLYMHGNSGNRASSHRVELYKLFQDLDYHVICFDYRSYGDSDVVELSEA
GVVMDSKYIFEWVMKKVNGSAPVFVWGHSLGTGVSTHVLALLATENIQPTGLFLEAPFNN
IADELTEHPFAQIFKHLPWFHWMIVEPFYKNNLRFESDKHIAKINCPVIILHAEDDGVIP
IHLADKLYQAAMNSHGNDTNRIQMIVIDSSYGFGHKYICRYKELPSIIEKFTAKAYGNQT
DLSE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaatgatccactagtaatagcagcagcattagtaccattcgtcatccttgag
atttggtacattggaataaatttagtttggagtatgaaggcatctgcattgttatatctc
gttttatttgggcttttgcctgtaatttttcattattcctacaccattcagagaaaaata
ctatttttaaattttgtgcaatggccaatcaaaatagaattttccaatccaaaattaatg
ggattggaaggtgctagaaatttttatttacacactgatcaacaagtgaaaataggtgta
tggcaaatattaccacggtctttattaaataattccattcctgcaacagatgaagcttat
gaagcagtgttaaataatgccaaacggcctgtgtttctatatatgcatggaaacagtggt
aatagagcaagttcccatagagttgaactttataagcttttccaagacttagattatcat
gtcatatgttttgattatagaagttatggagatagtgatgtggttgagctctcggaagca
ggtgtagttatggatagtaaatatatttttgaatgggtaatgaaaaaagttaacggttca
gctccagtttttgtctggggtcactcattaggaactggagtctctacacatgtattagct
ctgttagcaactgaaaatatacaaccaacaggattgtttttagaagcaccgtttaacaac
atagcggatgaattaacagaacatccattcgcacagatatttaaacatttaccatggttt
cattggatgattgttgaacctttttataaaaataacttacgatttgagtctgataaacat
attgccaaaattaattgtcctgtcataatattacatgctgaagatgatggtgtaattcca
attcatttggcagataagctttatcaggcagcaatgaatagtcatggaaatgatacaaat
cgtatccaaatgatagtaatagactcatcctatggatttggacacaagtatatctgtaga
tacaaggaattgcccagtataattgagaaatttactgctaaagcatatggaaatcagact
gacttatctgaataa

DBGET integrated database retrieval system