KEGG   Linepithema humile (Argentine ant): 105676501Help
Entry
105676501         CDS       T04898                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: palmitoyltransferase ERF2-like
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105676501
Enzymes [BR:lhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105676501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 105676501
NCBI-ProteinID: XP_012229876
Position
Unknown
AA seq 304 aa AA seqDB search
MNMTWAYRMAYKIGRHIYDIQYVKNCMKVFKKLCPLLTLSCTIFIIAFTSYINQKICPIF
FFLCMQVYLNWYSVYSISYRSNPLKIKEVQNNLFNVSVQTPKSVNSKNKFFVELGYMTYK
FWHCERCQGYMYKPTQHCSLCRKCFHFRDHHCFFLGACVLRQNMGNFILFCFYTSLTCLY
SLCVLGPYMYENVSHILSDTDYFNIFLNFCFPITLARLLQSRESLGVLLVTIFDLLMSIL
CICLVFGTWKLYSCLTGKQRYANVTGKQSLKEIFGSYGLSNIIFPYNGLIGTRDINDKYE
LKEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgacttgggcatacagaatggcatataaaataggcagacacatatatgatatt
caatatgtaaagaattgtatgaaggtctttaaaaagttatgtccgttattgacattatca
tgcactatattcatcattgcattcacgagttacatcaatcagaagatctgtccaatattt
tttttcctctgtatgcaagtatatttaaattggtactcagtgtatagcatcagctataga
tcaaatccattgaaaatcaaagaagtacaaaataatttgtttaatgtaagtgttcagacg
cctaagtctgtgaattccaaaaataagttttttgtggagctgggttatatgacctacaaa
ttctggcattgcgagaggtgtcagggttacatgtacaagccaacccagcactgctccctc
tgtcgaaagtgctttcacttcagggatcatcactgtttcttcctgggtgcttgtgtgctg
cgtcagaatatgggcaactttatactgttttgcttctacacttcactgacgtgcttgtac
tctttgtgcgtgctgggtccgtacatgtatgaaaacgtcagtcacattctgagtgacaca
gattacttcaatatattcttgaacttttgttttcccatcaccctggccagattgttgcaa
tccagagaaagtttgggtgtactactcgtcacgatattcgacctgctgatgtcaattttg
tgtatttgtctagtgttcggcacctggaaactttatagttgtttaaccggtaaacaacgt
tacgcgaatgttacgggaaagcaaagtctgaaagagatatttggaagctacggtctatcg
aatattattttcccatataatggtctcataggcacaagagacatcaatgacaaatacgaa
ttaaaggaggtgtga

DBGET integrated database retrieval system