KEGG   Linepithema humile (Argentine ant): 105676567Help
Entry
105676567         CDS       T04898                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00790  Folate biosynthesis
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105676567
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     105676567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Peptidase_S66
Motif
Other DBs
NCBI-GeneID: 105676567
NCBI-ProteinID: XP_012230000
Position
Unknown
AA seq 239 aa AA seqDB search
MATPYGRIIVYGGKGALGSTCISQFKSQNWWVGSIDMKPNEQANANIIVNPDNNWQEQQT
EILAQIKDVLKDGKVDGIICVAGGWAGGNAAHKDFVKNSDLMWKQSVWSSVIAANIAAEF
LKEGGFLSLTGAKAALEGTPGMIGYGMAKAAVHQLTKSLANKDSGLPSNSLITCILPVTL
DTPMNRKWMPKADTSTWTTLEFVSNLFWKWSQNQDRPTNGSLLQLITKDNKTEVIPSHI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccactccatatggacgtataattgtatatgggggcaagggtgccctcggctcaact
tgcatatcgcaatttaaatcgcaaaattggtgggtcggtagcattgatatgaagccaaat
gaacaggctaatgcaaacataattgtcaatcctgataataattggcaggaacagcaaaca
gaaattttagctcagattaaagatgtattaaaagatgggaaagttgatggcattatttgt
gtggctggaggatgggctggtggcaatgcagcacacaaagactttgtgaagaacagtgat
ttaatgtggaaacagagtgtttggagctctgttatagctgctaacattgcagctgaattt
ctgaaggaaggaggatttctttcattgactggtgctaaggcagcattagaaggaacacca
ggcatgattggttatggaatggcaaaagcagctgttcatcagctgacaaaatctttggca
aataaagatagtggtcttccttccaacagtttgataacttgtatactacctgttactttg
gatacaccaatgaacagaaagtggatgcccaaagctgatacaagcacgtggactacactt
gagtttgtgtcaaatctgttctggaaatggtctcaaaatcaagatcggcctactaatggt
tctctgttacaactcattactaaggacaataaaacggaagtgatcccaagtcacatataa

DBGET integrated database retrieval system