KEGG   Linepithema humile (Argentine ant): 105676795Help
Entry
105676795         CDS       T04898                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00010  Glycolysis / Gluconeogenesis
lhu00562  Inositol phosphate metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105676795
   00562 Inositol phosphate metabolism
    105676795
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105676795
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105676795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105676795
NCBI-ProteinID: XP_012230386
Position
Unknown
AA seq 453 aa AA seqDB search
MYEKLCFFILAICAVEGIPSNILKLKCDIEMSEKLETCYADNNNPYPFTGVKTAYDFVHS
NITKRIVLENCKPQQIWMLVRHGTRYPNEKGINQMLNLTHFRDFVISNHENHRRGHLCEK
DLENLKNWKPDPGLHPNRAKGLSSQGKKDLEMLGQRLKKEFPQLFGTCESHHCKFRSTDT
QRTVDSMNSFVKGAFSSTFTPNPEIVPSVNDTLLKIYDNCKPWEEMKVTQEMTKWINGPT
MTEVLANVSERLGLTYKLNFDDAFLIYDACRYQRAWYPEQRSPWCAAFTDDDIRVLEYEE
DLYHYYRVGPGVSVNSELGCHPLRDMLDRFSKLEDATEEEPAGVFYFTHSEMVMLFYAAM
SIGKDTPPITASNYREMGNRRWRSSLLTPFATNFAAVFYKCENSLIPFKVAFYLAEEPLN
LEGCVHGICDWQRLKKKLAPIAAKCSTKFCEKK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagaaactttgcttctttattttggcgatatgtgcggtagaaggcataccatca
aatatactaaaactaaaatgcgatattgaaatgtcagaaaaattggaaacgtgttacgca
gataacaataatccttatccctttaccggcgttaaaacagcgtatgatttcgttcacagt
aatatcacaaagcgtatcgttttagagaattgcaaaccgcagcagatttggatgctcgtc
agacatggcactcgatacccaaatgagaaaggaatcaatcagatgttgaacctgacgcac
ttccgagattttgttattagcaatcacgaaaatcacagacgcgggcatttgtgcgagaaa
gatttagagaatctcaagaactggaagcccgatcccggactccacccaaatagggcgaag
ggcctgtcgtcacaaggtaaaaaggacttggaaatgctgggccaaagactcaaaaaggag
ttcccgcagcttttcggcacgtgcgagtcgcatcattgtaagttcaggtcaacggacacg
cagcgcaccgtcgatagcatgaactcgtttgtaaaaggagcttttagcagcacgttcact
cctaatccagaaatagtgccgagcgtcaatgatactttgctgaagatatacgataattgc
aagccatgggaggaaatgaaggttactcaggaaatgactaaatggattaatggtccgaca
atgacagaagtccttgccaatgttagtgaacgattaggcttgacgtataaacttaacttc
gacgatgcatttttgatctacgacgcgtgtcgataccagagagcttggtacccggagcaa
agatcgccctggtgcgccgcgttcaccgacgacgacatacgagtgctcgaatacgaggag
gatctttatcactattatcgcgttggtccgggagtgagcgtcaacagcgagctcggatgc
caccctcttcgagacatgttagatcgtttctcgaaattggaagatgcgacggaagaagaa
ccggcgggcgtgttttacttcacgcattcggagatggtgatgctgttctacgcggcgatg
agcatcggcaaggacacgccgcccatcacggcctcgaattacagagaaatgggaaacaga
aggtggaggtcctccctgttgacgccgttcgccacaaatttcgcagctgttttctacaaa
tgcgagaacagcctgattcccttcaaagtcgctttctacttagccgaggagcctttgaat
ctcgaaggctgtgtgcacggaatctgcgactggcaacgcttgaagaagaagctggctccc
atcgcggcgaagtgcagcacgaaattttgcgaaaaaaaataa

DBGET integrated database retrieval system