KEGG   Linepithema humile (Argentine ant): 105677726Help
Entry
105677726         CDS       T04898                                 

Definition
(RefSeq) venom acid phosphatase Acph-1-like
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105677726
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     105677726
    3.1.3.5  5'-nucleotidase
     105677726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105677726
NCBI-ProteinID: XP_012231964
Position
Unknown
AA seq 415 aa AA seqDB search
MNEFYLICITLALQICIIPSLAVPELKLVHVLFAHKLHAPKKNNAKNDPEISIPQNLSYE
YFTSAATDMSKNAKLNMYNFGVHLRKIYGDFLGDLYFSDIMKMRTTEYTLSMLSAQLVNA
GLWPPSNSQTWMEGFNWQPIPSDYLELEDDTLLLGSLCPNFVSQMDEILRRNETRKMMAQ
YQPLFDHLSEYTKREINTPSDVAVLYAILETMADQSEILPNWAMDVFPDGAMYNVSLLEY
DLLSETLLQRQLNGGILLEEIIGNSLKYSMGDISKKRKLMLYSGDERNIVGVLKSLDLWS
PHIPNEAAALIFELYFDNDINLYGMKINYYTGIDDKTISLSLPNCTEICPLQTLIDIAFV
TIPQNPQSLCGWSVRNPAETEDQLNRSEESNSTNHNLSKNLIFILILLNLKFGNF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattctatctcatctgcattacgcttgcattacaaatctgtataattcccagt
ctggctgtgccggaactaaaattggtgcatgtattgttcgcacataaattgcacgcgcca
aagaaaaacaacgcgaaaaatgatccggaaataagcatcccgcaaaacttatcatacgaa
tacttcacttccgctgcgacggacatgtcgaaaaacgcgaagctcaacatgtacaatttc
ggtgtgcatttgcgcaagatctacggagactttttaggcgatctatatttttccgacatt
atgaaaatgcgcacgacggagtacaccttgtcaatgttatcggcccagcttgttaacgcc
ggtttgtggcctccctcgaatagtcaaacgtggatggaaggtttcaactggcagccgata
ccatccgattacttggaattagaggacgacacgttactgctgggttctctgtgtccaaat
tttgtttcacagatggacgaaatattgcgaaggaatgaaactcgaaagatgatggcgcag
tatcaacctctcttcgaccatctttctgaatacaccaagagggaaatcaatacaccgtcg
gatgtggctgtcttgtatgcgattttagaaacgatggctgaccaaagtgaaatattaccg
aattgggcgatggacgtgtttcccgatggtgcaatgtacaatgtgtccttgctggaatat
gatctactctcggagactcttctgcagaggcagcttaacggtggaattctcttagaagaa
attatcggcaactcgttgaagtactcaatgggcgatatatcgaaaaaacgaaaactaatg
ctgtacagcggcgacgaaagaaatatcgtcggagttctaaaaagtctcgatctttggtcg
cctcacattcccaacgaagcagccgcattgatctttgaattgtactttgacaacgatatc
aacttatacggaatgaagatcaattattacactggtatcgatgacaagacgatctctctg
tcactgccgaattgtacagagatttgcccgttgcagactttaatagacattgctttcgtt
acgataccgcagaatccgcaatctttatgcggatggtccgtgagaaatcccgcagaaacg
gaagatcagttaaacagaagtgaggaatccaattctacgaatcataatctcagcaagaat
ctaatatttattttaatattattaaatcttaagtttggcaacttttaa

DBGET integrated database retrieval system