KEGG   Linepithema humile (Argentine ant): 105678845Help
Entry
105678845         CDS       T04898                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase 32E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00230  Purine metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105678845
Enzymes [BR:lhu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105678845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA Vpu
Motif
Other DBs
NCBI-GeneID: 105678845
NCBI-ProteinID: XP_012233950
Position
Unknown
AA seq 1472 aa AA seqDB search
MRPGPSVEPSRRRPPRRQHPHQQQLHRERDRQQQQQQQQQHWLHPWRLRFNSSRALLVLL
LLASSPLVLGLTEPPGSSTAAAAPATQCQQAHKSQLKSGNNAVKNLTIGYLTAIKGGLKD
RQGLAISGALSMALDEINNDTSILPNVTLVMRWNDTRGETVEATNAMIEMICDGVVAFFG
PEGSCYVEAIVAQARNIPMISYQALRNRGGAQKAIAHSVIQKCSDYKASRVNTFVRTEPP
DTQVTKSVIALLLHYGWNKFTIVSERAWVTVARSLNDESSKSNLTVNHYKIVEDRHTCCE
ERMSCCQVSVWFQIIQETKNMTRIYIFLGTPMSLIDMMNSMQSQRLLDDGEYMVIYVDMM
TYSPREAQKYLWKPEHFDILKNCMEPKDFLKRARSLMVVVSTPPTQNYEEFTKKVREYSV
KEPFNFVIPELLRKYEKYVSIYAAYLYDSLKLYARALHQLTIDHADQSVEELARNGTLII
ETIIKNRTYQSVSGATIKLDKYGDSEGNFSVLALKKEALHQDNFTCEYQMAPVGQFQQGE
TLVYRPTGAMDWPGKNKPEAEPGCGFLNEHCPKDDTHFRSITVAIVLFVALFIVALFAMT
LYRRWKIEQEIEGLLWKIDPSEIHGYPHLDNMMSSPSKLSLVSAMSYESRCGNQVFAQTG
HYHGVVVRIKELKFSKKKDISRDVMKEMRVLRDIRHGNLNSFIGACVEPMRILLITDYCA
KGSLYDIIENEDIKLDDMFIASLIHDLIKGMLYIHESSVLVCHGNLKSSNCVVTSRWVLQ
VSDFGLHDMRHCAESDSIGEHQYYRNLFWKAPELLRNPHASIRGTQEGDIYSFAIILYEI
LGRKGPYGNINLEPKEIIDRVKKLPQDGEPPFRPNLNILSESKTNCADYVINTIMDCWAE
SPEFRPDFKTIRIGLKKMKAGWHRNIMDQMMNMMEKYASNLEDLVTERTGLLLDEKKKTE
DLLHRMLPKPVANCLTNGIGVEPEAFDLVTIYFSDIVGFTAMSAESTPFQVVNFLNDLYT
LFDRIIRGYEVYKVETIGDAYMVVSGLPIRNGDQHAGQIASMSLELLNAVKHHTIPHRPQ
ETLKLRIGIHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGEPLRIHISQQCKEALDK
IGGYKIEERGFIEMKGKGTVKTYWLTGATVTHRKNTENFNMDENLPPLFCRPRKSPKLNP
DSRYASLLEGLGGGSRRQSAVPYPMADDSSSQCGGSSPVPRPLHARKIEKSPLCLTESVS
KTTLDNVSIQEDMEGHANNIKSVDDLFTISGPKLRKNARALSTIASSSSSDYPSQTVIRG
SRSLDPLPTEMYNKRYNNSSPNFWKENECTRTDSKMDISEKMLNNNYPNGNVIMVPHTDN
SPNEAEPLLGDESEGKGYIREKRSRSLDQVVSASSTDSVPDXKSSARKLLEIPPVSTIIQ
MFNGNGLRSSNVSLRRGVIPGYDKQTERESVV
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccggcccgtcagtagagccgagccgccgcaggcctccccgtcgccagcatccg
catcagcagcagctccatcgggagcgcgatcgacagcagcaacagcaacagcaacagcaa
cattggctgcatccgtggcggttgcgcttcaacagttcgcgcgctctcctggtgctgctg
ctactggccagcagccccctggtcctgggtctgactgagccgccaggatcatcaacagct
gcagcggccccagcgacccagtgccagcaggcacacaagagccaactgaagtcggggaat
aacgcggtgaaaaatttgaccatcggttacctcacggccatcaagggcggcctcaaggat
cgtcagggtctcgccatctccggcgccctgtccatggccctcgacgagatcaacaacgat
acaagcattctgccgaacgtgacgctagtgatgcgatggaacgacacgaggggagagact
gtcgaagctaccaatgcaatgatcgagatgatctgcgacggggtcgtggccttcttcgga
ccggaaggctcctgctacgtcgaggccatagtcgctcaagcccgcaacatacctatgatc
agttaccaggcgctgcggaaccgagggggggcacagaaggcgatcgcccactcagtaatt
cagaaatgctcagactacaaggcttcgagagtgaacaccttcgtgaggaccgagccgcca
gacacgcaggtgaccaaatcggtgatcgccttgctgttgcactacggatggaacaaattc
acaatcgtgagcgagcgcgcatgggtaacggtcgcccgttcgctgaacgacgagtcgagt
aagagcaatctcaccgtgaaccactacaagatcgtcgaggatcggcacacgtgctgcgag
gagagaatgtcttgctgccaagtcagcgtatggttccaaattatacaggagaccaaaaat
atgacccgcatttacatcttcctgggtacgccaatgtcactcatagatatgatgaattcg
atgcaaagccaaaggctgctggatgacggggagtacatggtaatatacgtggacatgatg
acgtattcgccgcgcgaagcacagaaatatttgtggaaaccggaacacttcgatatattg
aagaattgtatggagccgaaggactttctaaagagggcacgctcgctgatggtggttgtg
tcaacgccgccaacgcagaattacgaggaattcactaagaaggtccgagagtatagtgtt
aaggagccattcaacttcgtgatccccgagcttctgagaaagtatgaaaagtacgtgtcc
atttatgcggcgtatctctacgattctctcaagctgtacgcaagagccttgcatcagcta
actattgatcatgcggatcaatctgtcgaggagctcgctagaaatggcactcttataatt
gagacgattatcaagaatcgtacatatcaaagtgtaagtggggcaaccataaaattggac
aaatatggggactcggaaggaaatttttcggtactcgctcttaagaaggaggcgttacac
caggacaattttacctgcgagtatcagatggccccggtgggccagttccagcagggtgaa
actctagtatacagaccaacgggagccatggattggcctgggaaaaataagccggaggca
gagcctggttgtggttttctcaatgaacattgtccaaaggacgatacgcatttccgtagt
atcaccgtcgccatcgttctctttgttgcgttgttcatcgtcgcgttgttcgctatgact
ctgtatcggaggtggaaaatagagcaggagatagaaggattgctttggaagattgatccg
agcgagatacacggttatcctcatcttgacaacatgatgtcctcccctagtaagttaagt
ttagttagtgcaatgtcctatgaatcaagatgcggcaaccaagtatttgcgcaaactggg
cattaccacggtgtagtggtgcggataaaggagctgaaattctcgaagaaaaaagatatt
tcacgggacgttatgaaggagatgcgcgttctccgtgatattagacatggtaatctcaac
tctttcatcggagcgtgcgtggagccgatgaggatattgttaattaccgactattgtgcc
aaaggaagtctttatgacattatcgaaaacgaagatataaaattagatgatatgtttatc
gcatcgttaattcacgatctcattaagggtatgctgtacattcacgagtcatctgtgcta
gtctgtcatggtaatttgaagtcttccaattgtgttgtgacttcacgttgggtgctccaa
gtctccgatttcggtcttcatgatatgcgtcattgcgccgaatctgacagcattggtgaa
catcagtattatcgaaacttgttttggaaagctcccgagctgctaagaaatccgcatgcc
tcgattagaggcactcaggaaggggatatttattcttttgccattattctgtatgaaatt
cttgggcgaaaagggccgtacggaaatatcaatctggaacccaaagaaatcatagaccga
gtaaaaaagttaccacaagatggtgaaccgccgttcaggcccaacttaaatatactctcc
gagtcgaaaacaaattgcgccgattatgttattaatactattatggactgctgggcggaa
agtccagaatttaggccagacttcaagacgataagaatcggcttgaagaagatgaaagcc
ggatggcaccgaaacataatggatcaaatgatgaatatgatggagaaatatgcaagcaac
ctcgaagatctagtcaccgagcgtacgggacttcttttggatgaaaaaaagaaaactgaa
gatctgcttcatagaatgttacccaagcctgtcgcgaattgtttaacaaacggtatcgga
gtggaaccagaagctttcgatttggttactatatacttcagcgatatcgtcggtttcacg
gcaatgtcggcggaaagcactccgtttcaggttgttaatttcttgaatgatctgtataca
ttattcgatcgcataattagaggatacgaagtgtacaaagtagaaacgattggagatgct
tatatggtcgtctccggtcttccaataaggaatggagatcaacatgccgggcagatagca
tcaatgtcgctggaattacttaatgccgttaaacaccacacgatacctcatcgacctcaa
gaaactcttaagctacgtattggtattcacactggtcctgtagtagcgggtgttgttggt
ttaacaatgcctagatattgtttgttcggggacaccgtcaatacggcgtctcgtatggaa
tctaccggggaaccattacggatacatatcagtcaacaatgtaaagaagctctcgataag
atcggaggttacaagatcgaggaacgaggcttcatagaaatgaaaggaaagggaacagtg
aagacgtattggctcacgggagctactgtgacgcacagaaaaaatacagagaactttaat
atggacgaaaatcttccaccgctgttctgccgaccgcggaaaagtccgaagctaaatcca
gactcgcgatatgcatcactgctagagggattaggcggtgggagtcgtagacaatcagct
gtaccatatccaatggcagacgattcgtcttcccaatgcggtggatctagtccagttcct
cgaccactgcatgcgcgcaagattgagaaatctcccctatgcctgaccgaaagcgtttcg
aagaccacgctagacaatgtttcgatccaggaagacatggaaggacacgctaacaatatc
aaatcagtcgatgatttgtttacgatctcggggccgaagcttaggaaaaatgcgcgcgca
ttgtccacgatcgcgtcttcgtcatcaagcgactatccatctcagactgttatacgcgga
tctcgctcactggacccgcttcccaccgaaatgtataacaaacggtataacaattcgtca
ccgaatttctggaaggagaacgagtgcacgcggactgattcgaaaatggacatttctgag
aaaatgctaaataataattatcctaacgggaatgtgataatggtgcctcacactgataac
tccccgaacgaagcggagccactgttaggcgacgagagcgaaggcaaaggatacattcgg
gagaaacgttcgcgctcgctggatcaagtggtatctgcgtctagcacggacagtgtacct
gacnaaaaatcttccgcgcgaaagttgttggaaattccgccggtttcaactatcattcag
atgttcaacggtaacggattgcgtagtagcaacgtctctttaaggagaggcgtaatacca
gggtacgataagcaaactgaacgtgaaagtgtagtctag

DBGET integrated database retrieval system