KEGG   Linepithema humile (Argentine ant): 105679173Help
Entry
105679173         CDS       T04898                                 

Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00340  Histidine metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    105679173
Enzymes [BR:lhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     105679173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 105679173
NCBI-ProteinID: XP_012234480
Position
Unknown
AA seq 719 aa AA seqDB search
MNLDEYRKHGKEMVDYIADYLENIRSRRVYPAVSPGYLRNVLPTSAPVDGERWEDIFADI
EKCIMPGVTHWQSPHMHAYFPALNSPASLLGDMLADAINCLGFTWASSPACTELETIVMN
WLGKMIGLPEDFLHYPGSSGGGGVIQTTASEATLVCLLAARTRAIRDVQENDPECLATEI
NSRLVAYCSDQAHSSVEKAGLIGLVRMRYIESDSELSMRGDALLEALTRDRAEGLLPFFV
CATLGTTGACAFDNLKEIGPICQKNSLWLHIDAAYAGSAFVCPEFRGWLQGVEHADSIAF
NPSKWLMVHFDCTAMWVKNSQALHRTFNVDPLYLKHENTGLAIDYMHWQIPLSKRFRALK
LWFVIRNYGITGLQKHIREGVRLAQKFEALVLADARFEIPASRHLGMVVFRLRGENTLTE
RLLKKLNSRGRLHCVPAALHEKYVIRFTVTSTNTTNEDIVKDWAEIRNTANEILGDTSAP
IARARVPLADTRQKNENFGSSLLLANSPMSPKIVNGSFAAIYDTADVFEECMKTFGKIHL
EARDSPAMRRRIRGILMSGKQFSLDSRMDLVQGYVCSRPLSDPPTELPLMKEDEDTAAYE
SMSDIDKLDEIDNDESFDNSETSKRKVSISKTGSNYAVVNGSIVNIDTEDNGDNTVTIAA
ADVGFPRSETIAAFGHRPYTGDLEPVRILREKLMKGQRNEGNDDNGDFCRKCGHYSKRQ
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggatgaatatcgcaaacatggaaaggaaatggtggattacatcgctgattac
ttggagaatatccgttctcggcgcgtatatccagcagtctcaccgggatacttaagaaat
gtcctgccgacgtcggccccggtcgacggcgaacgctgggaggatatattcgccgacatt
gagaaatgcattatgccgggtgtgacgcattggcagagtccacacatgcacgcttacttc
ccagccctgaattcacctgccagtctgctaggcgacatgctggctgatgctataaactgt
ttgggtttcacgtgggcttccagcccggcgtgtaccgaattggaaacaattgttatgaat
tggttgggcaaaatgatcggccttcccgaagattttctgcattatccaggtagctccggc
ggcggtggtgttattcaaacaacagcatcagaagctacgttggtgtgcttgctggcagct
agaactcgggctatcagggatgtgcaggaaaacgatcctgagtgtttggcgacagaaatc
aattcgcgactagtcgcttactgctcagatcaggcacattcaagcgtagaaaaagctgga
cttataggtttggttcgaatgcgatacatcgaatccgacagtgaattaagcatgagagga
gatgctttactcgaagcattaactcgcgatcgcgctgaaggtctacttcctttcttcgta
tgtgcaactttaggcactactggtgcttgcgctttcgataacctcaaagaaattggaccg
atatgtcaaaagaacagtttatggttgcatattgatgcagcctatgcaggcagtgctttc
gtatgtcctgaatttcgtggttggcttcaaggagtcgagcacgccgactcaattgctttt
aatccaagtaaatggctcatggtccacttcgattgtacagctatgtgggtgaaaaacagc
caggcgttacacagaacctttaatgtggatccgctgtatttgaagcatgaaaatacaggt
cttgcaattgattacatgcactggcagattcctctatcaaaaagatttcgggcactaaaa
ctatggttcgttatcaggaattatggaattactggtttgcagaaacatatacgagaaggc
gtgaggttagcacaaaaatttgaagctttagtcctggccgatgctcgttttgaaattcct
gcttcgaggcatttgggtatggtagtttttcgtcttcgtggtgagaacactttaacagaa
cgtttgctgaagaagcttaattcacggggtcgattgcattgtgtgccagccgccttacac
gaaaaatatgtcatcagatttacggtcacttcgacaaataccacgaatgaagacattgta
aaggattgggcagaaatacgaaatactgcaaatgaaatattaggtgatacctccgcacct
atagctagagctagagttcctctcgcagacacacggcagaagaatgagaattttggatca
agtttgctattggcaaattcgccgatgtcgccgaaaattgtgaacggtagtttcgccgcc
atatatgacacggctgacgtatttgaggaatgtatgaagacttttgggaaaattcatctt
gaggcaagagatagtccggccatgcgtcgtcgtattcgcggaatactaatgtcaggcaaa
caattttctttggattctcgtatggatcttgttcagggatatgtttgcagccgtccactc
tcggatcctcctaccgagttaccattaatgaaagaggatgaagataccgcggcatatgag
tcaatgtctgatatcgataaactggatgaaatcgataatgacgagtcatttgataactct
gaaacgagcaagaggaaagtatctatttcaaagactggttcgaattacgcagtagtaaac
ggttcaatcgtcaatatcgatactgaggacaatggcgataacacggtgaccattgcggcg
gctgatgtaggcttccccagaagtgaaactatagctgctttcggccatcggccgtataca
ggcgatttggagcctgtacgaattttgagggagaagttgatgaaaggacagagaaacgaa
ggaaacgacgacaacggggacttctgcaggaaatgtggtcactactccaaacgtcagtaa

DBGET integrated database retrieval system