KEGG   Linepithema humile (Argentine ant): 105680087Help
Entry
105680087         CDS       T04898                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00430  Taurine and hypotaurine metabolism
lhu00480  Glutathione metabolism
lhu00590  Arachidonic acid metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105680087
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    105680087
   00480 Glutathione metabolism
    105680087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lhu01002]
    105680087
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lhu04090]
    105680087
Enzymes [BR:lhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     105680087
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     105680087
    3.4.19.14  leukotriene-C4 hydrolase
     105680087
Peptidases and inhibitors [BR:lhu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   105680087
CD molecules [BR:lhu04090]
 Proteins
  105680087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 105680087
NCBI-ProteinID: XP_012235938
Position
Unknown
AA seq 675 aa AA seqDB search
MRNRQHVFQRRTMRASSLSSSSTSSVYTSADDVRRCTGHEGNQFLDSENVGTAWLLDSHR
SQNRSKWVIETFKVNKSRLRNGRNIIFSIGVVIVLAIIISLGVCMRDNISDSQHDKILVL
PDPENLQPPSWSKLKTFKRGAVCADGAPCAVIGNSILEQNGSAVDAALAALICNGLVNMQ
SLGFGGGFLMTIYERSTSQAFVLNARDRAPLAANSTMYNGKPADASVLGALAVAVPGELA
GYWEAHQRFGKLPWADLFQPSIELCEKGYVLTLVQYDALEYNKKSIYNDATLKELFLDPV
TKQFRKPGSIIKPHALCKTLRIIAEKNATEFYNGTIGQLLVDDLQEQGGIITMQDLNEYR
VSWDQPIQTNLSGGIKLFTTGLPGSGSILSFILNVFDDYGFTPASIADFNATTLTYHRMI
ETFKYAYALRTNLGDGAFVDMTEITKNLTSKDFARAIRKKISDNRTWHDPRHYGCSIGAG
VEDHGTAHVSVLAQNGDAVSITSTINYYFGSGVVSKRTGILLNNGMDDFGIPLKHNYFGI
PPSPNNYIAPKKQPLSSMVPSVFVDQHGDVKMVVGAAGGTKITTAVSQVIAKIFWMQQTV
KEAVDSARIHHQLFPPEVAYEYGIPKQVIDGLKQLGHAVERYRERGSIACVLFYANSTIF
ANADYRKGGDVYGIN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacagacagcatgtcttccaaaggagaaccatgagagcctcttcgctctcgagt
tccagcacgagttctgtatataccagcgccgacgatgtgcgccggtgcaccggtcacgag
gggaatcagtttctcgattcagagaatgttggaaccgcctggctgctcgattcgcatcgt
tcgcaaaatagatcgaaatgggtgatcgaaacatttaaagtaaacaaatcacggttacga
aacgggcgaaacataatcttcagcatcggtgttgtaatcgtgttggcaatcatcataagc
ctcggtgtttgcatgcgtgataatatctcagactcacaacatgacaaaattcttgtactg
cccgatccggaaaacttacagccgccatcgtggagcaagttaaaaactttcaaacgcggt
gctgtttgcgcggacggagcaccgtgtgctgttatcggcaattcaattttagaacagaat
ggatcggcagtggacgctgcgctggccgcgctaatatgcaacggactcgtaaatatgcaa
agtctgggatttggcggtggatttttgatgacaatttacgaaagatctacgtctcaggct
tttgttctcaatgctagggaccgcgcacctctcgcggcgaattctacgatgtataatggc
aagcccgcagatgcgtcggtactcggcgcattggcggtcgccgtgcccggtgaactggcc
ggctactgggaagctcatcaacgattcgggaaactgccttgggcagatttgttccaaccg
agtatcgagctctgtgaaaaaggctatgttttaacactggtgcagtatgacgcgctggag
tacaataaaaaaagcatttataacgatgcaactttaaaagaattgttcctcgaccctgtg
acgaagcaatttcgtaaaccaggatccatcattaaaccccacgcactttgcaaaacactg
cgaattattgcggagaaaaacgcgacggaattttataacggcaccattggacaacttctc
gtcgacgatttgcaggaacagggtgggattataacaatgcaggatcttaatgaatataga
gtatcgtgggatcaaccgatacagacgaatctctcgggcggaataaagctcttcacgaca
ggactacccggtagcggaagcattctctcatttattctcaacgtcttcgacgattacggt
ttcacgccggccagcatagctgattttaacgcgacgacgctcacgtatcacaggatgata
gagacgtttaagtatgcatatgctttaaggacgaatctaggcgacggagctttcgtcgat
atgaccgaaataaccaaaaacctgacgtcaaaggactttgcacgcgcgatacgaaaaaaa
ataagcgataacagaacgtggcacgatccgcgacattacggctgttccatcggcgccggt
gtcgaggatcacggcactgcacacgtgtcggtgctcgcacaaaacggcgatgccgtgtcg
attaccagcaccattaactattatttcgggagcggagtcgtcagcaaaagaaccggcatt
ctgcttaacaacggtatggacgattttggcattccgttgaagcacaattactttggtata
ccacccagccctaacaattacatcgcgcctaaaaagcagccgctatcttcgatggtgcca
tccgtgttcgtcgaccagcacggtgatgtcaagatggtcgtgggcgccgctggcggtaca
aaaattacaaccgccgtatcccaagtgattgcaaagatcttttggatgcagcagacagtt
aaagaagcggtggactcggcaaggatacatcatcaattgtttccaccggaagtggcttac
gaatatgggattcctaagcaagtgattgacggcctgaagcagctgggacacgctgtggaa
cgctacagagagcgcggcagcatagcctgcgtgttgttctacgcaaattccacgattttc
gcaaacgccgattatcgcaaaggcggcgatgtttacggaattaactga

DBGET integrated database retrieval system