KEGG   Lactobacillus helveticus CNRZ32: lhe_0590Help
Entry
lhe_0590          CDS       T02744                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhv  Lactobacillus helveticus CNRZ32
Pathway
lhv00071  Fatty acid degradation
lhv00072  Synthesis and degradation of ketone bodies
lhv00280  Valine, leucine and isoleucine degradation
lhv00310  Lysine degradation
lhv00362  Benzoate degradation
lhv00620  Pyruvate metabolism
lhv00630  Glyoxylate and dicarboxylate metabolism
lhv00640  Propanoate metabolism
lhv00650  Butanoate metabolism
lhv00900  Terpenoid backbone biosynthesis
lhv01100  Metabolic pathways
lhv01110  Biosynthesis of secondary metabolites
lhv01120  Microbial metabolism in diverse environments
lhv01130  Biosynthesis of antibiotics
lhv01200  Carbon metabolism
lhv01212  Fatty acid metabolism
lhv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lhv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lhe_0590
   00630 Glyoxylate and dicarboxylate metabolism
    lhe_0590
   00640 Propanoate metabolism
    lhe_0590
   00650 Butanoate metabolism
    lhe_0590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lhe_0590
   00072 Synthesis and degradation of ketone bodies
    lhe_0590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lhe_0590
   00310 Lysine degradation
    lhe_0590
   00380 Tryptophan metabolism
    lhe_0590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lhe_0590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lhe_0590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lhe_0590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhv04147]
    lhe_0590
Enzymes [BR:lhv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lhe_0590
Exosome [BR:lhv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lhe_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGQ23140
Position
668213..669373
Genome map
AA seq 386 aa AA seqDB search
MKNIYIVAAKRTPFGKYRGFFKDASSIDLGVMALKGALKAGNIDPNDVQELFMGNVLSTG
LGENMARQVALNSGMRKESTAATINDVCGSSLKAVRLAQGQMELGDLDLVAVGGSESMTR
APYFVKKENKENPADHLVNTMINDGLMDAFSGQHMGITAENVAQRYHVSREEMDEFSLRS
HKKAADATKSGFFDNEILPIEINGETLDHDEPIRSDTSMAALSQLKPVFKEDGDVTAGNS
SPLTDGASMLVLATEDKVKDLNLKPIAKLGGFAEAGFDPAYMGYTPYFAVKKLLKKTGRS
INDYDIVELNEAFASQSVAVARDLQIPDDRLNIMGGAIALGHPLGATGTRLICSAISGLK
KEQGQRALVTLCIGGGQAIAYEIENI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttatattgtagcggccaagaggacaccttttggcaagtatcgtggattt
tttaaagatgcttcgtcaatcgatcttggtgtaatggcgttaaagggagctttaaaagca
ggaaatattgatcctaatgatgttcaagaacttttcatgggaaatgtgttgagtacaggc
ttaggtgaaaatatggcccgacaggttgctcttaactcagggatgagaaaagaatcaact
gcggcaacgattaatgatgtttgtggctcaagtcttaaggctgttcgtctggctcaaggt
caaatggaactaggcgacctggatttagtcgcagtgggtggtagcgaaagcatgactcgt
gcgccatattttgttaaaaaagagaataaagaaaatcctgcagatcatttagtaaatact
atgattaatgatggtttgatggatgctttttctggacaacatatggggattaccgctgaa
aacgttgctcaaagatatcatgttagtcgtgaagaaatggatgaatttagtcttcgttct
cataaaaaagcggcagatgcaacaaaatccggcttttttgataatgaaattttaccaatt
gaaattaatggtgagactttagatcatgatgaaccaattcgttctgacacttctatggca
gcattaagccaattaaaacccgtctttaaagaagatggtgacgtgacagctggcaattcc
tcaccgttaacagatggagctagtatgttggtattagccacagaagacaaggttaaagat
ttgaacttaaagccaatcgctaagctggggggctttgcagaggctggatttgatcctgct
tatatgggatatacgccatattttgctgtgaaaaaattgcttaaaaagacaggacgttca
attaatgattatgatatcgtggaactaaacgaagcttttgcttcacagagtgtagcagta
gcacgtgatttgcaaattcctgatgatagattgaatatcatgggcggtgctattgcatta
ggacatccgttaggtgctactggaactagattgatttgttctgcaatcagtggcttgaag
aaagagcaaggtcaacgtgcattagtaaccttgtgcattggcggtggccaagcaatcgca
tatgaaatcgagaatatctaa

DBGET integrated database retrieval system