KEGG   Lactobacillus helveticus CNRZ32: lhe_0745Help
Entry
lhe_0745          CDS       T02744                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lhv  Lactobacillus helveticus CNRZ32
Pathway
lhv00430  Taurine and hypotaurine metabolism
lhv00620  Pyruvate metabolism
lhv00640  Propanoate metabolism
lhv00680  Methane metabolism
lhv01100  Metabolic pathways
lhv01120  Microbial metabolism in diverse environments
lhv01200  Carbon metabolism
Module
lhv_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lhv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lhe_0745
   00640 Propanoate metabolism
    lhe_0745
  09102 Energy metabolism
   00680 Methane metabolism
    lhe_0745
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    lhe_0745
Enzymes [BR:lhv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     lhe_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AGQ23278
Position
855887..857071
Genome map
AA seq 394 aa AA seqDB search
MKKVLAINSGSSSFKYKLFSLPDEKVIASGMADRVGLDNASFEIKLADGTKHVEKTEIAD
QEAAVNLLIKFLKQFNVVDDLHEIVGVGHRVVNGGEYFDDSTIITKENLPKIYELEDYAP
LHNPAEGHGIEAFMNVLPEVPQVAVFDTTYHRALDPVHYLYSLPYEYYEKYGVRKYGAHG
TSIRYTAPHAAKMLGKDLKDLKLIICHLGSGASITAVKDGKSYDTSMGFSPIAGITMATR
CGDIDPSLIQHLMHVEGKSMDEMIHILNHKSGLLGLSGISPDMRDISESDTERAKLARKI
FINRIVRYVGSYIAEMGGIDAIIFTAGIGEHDMSVRKEVMDAFKYMGVEPDYEANEENGE
HFITKPDSKVKVMVIPTNEELIIERDVVRLTNIN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttttggcgattaactcaggtagttcatcttttaaatataagttattttca
ttgccagatgaaaaagtgattgcaagtggtatggctgatcgtgttggattggacaatgct
tcttttgaaattaaattggctgacggcactaagcatgtagaaaaaacagaaattgccgat
caagaagctgcagttaacttgttaattaaattcttgaagcagtttaatgtagtagatgat
ttgcatgaaatcgttggcgtgggtcaccgtgtagttaatggtggtgaatacttcgatgat
tctactattatcaccaaggaaaatttacctaagatttatgaactagaagattatgctcca
cttcacaacccagctgaaggccatggaattgaagcatttatgaatgtattgccagaagta
ccacaagtagccgtgtttgatactacttatcatcgcgctcttgatccagttcactactta
tattctcttccttatgaatactatgaaaaatatggtgttcgcaagtatggtgcacatggc
acatcaatccgctatactgcacctcatgctgctaaaatgctcggcaaagatttaaaggat
ttaaaattaattatttgtcacttaggttcaggtgcttcaattactgctgtaaaagatgga
aaatcgtatgacacttcaatgggctttagtccaattgctggtatcacaatggcaactcgt
tgtggtgatattgacccatcacttattcaacatttaatgcatgttgaaggaaaatccatg
gatgaaatgattcatatcttgaatcacaaatctgggttgcttggcttatcaggtatttct
ccagatatgcgtgacatcagtgaaagcgacacagaacgtgctaaacttgcaagaaagatt
tttattaatagaatcgttcgttacgttggttcatatattgctgaaatgggcggcattgat
gctattatctttactgctggtattggtgaacatgatatgagcgtacgtaaggaagttatg
gatgctttcaagtacatgggtgttgaaccagattatgaagcaaacgaagaaaacggtgag
catttcattactaagccagattctaaggtgaaggtaatggttattccaactaatgaggaa
ttaatcattgaacgtgatgtagttcgtttgactaacattaattaa

DBGET integrated database retrieval system