KEGG   Lactobacillus helveticus CNRZ32: lhe_0940Help
Entry
lhe_0940          CDS       T02744                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase / synthetase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lhv  Lactobacillus helveticus CNRZ32
Pathway
lhv00770  Pantothenate and CoA biosynthesis
lhv01100  Metabolic pathways
Module
lhv_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lhv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    lhe_0940
Enzymes [BR:lhv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     lhe_0940
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     lhe_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein SIS
Motif
Other DBs
NCBI-ProteinID: AGQ23451
Position
1100793..1101986
Genome map
AA seq 397 aa AA seqDB search
MTRITVYLTGGIAAYKAVQVVRNLEKQGHEVRIVMTKNAEHFVTTNTLAALTKYPVLDDL
WEKANEASIPHVHLARWSQLALIVPATANFISKMANGIADDTASTTILATKAPKLVVPAM
NDQMWNNPATQRNIALLKGDGVHVMEPATGMLAEGYAAKGRMPEPEDITAWVQDILDENK
ILKNKTIVVTAGGTQEAIDPVRFIGNRSSGKMGIAIAQKAAEAGAQVKLIYGNVTIPLPK
ANNIELIHASSSEAMLKAVEDKFQHADVLIMAAAVADWRMEKVADHKLKKNPEQDTLSLT
LVKTKDILHEVSSHKKANQVVVGFAAETNDLLKNAEKKLKNKGADMIVANDVSNNVFGND
KDQVVILQNNTKIEKWPLMTKQEIAVALIKKIANKLK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaataacggtttatttaacaggtggaattgcagcttataaggctgttcaagtc
gttcgcaatttagaaaaacaaggacatgaagttcgaatagtaatgaccaaaaatgcggag
cattttgtaacgactaatactttagccgctttaacaaaatatccagttttagatgattta
tgggagaaagcaaatgaagcaagcatccctcatgttcatttagcacgctggagtcaattg
gctttaattgtacctgctactgcaaactttattagcaaaatggctaatggaattgcagat
gatacagccagtacgactattttggcaacaaaagcgcccaaattagtcgtgccagctatg
aatgatcaaatgtggaataatcctgcaacccagcgtaatatagcgcttttaaaaggtgac
ggtgttcatgtgatggagcccgcaactggaatgctagctgaaggctatgctgcaaagggc
agaatgcctgaaccggaagatattacggcttgggtgcaagatattttggatgaaaacaag
atcttgaaaaataaaacgatcgtagtgacggctggcggtacacaagaagcaattgatcca
gttcgttttattggtaatcgttcaagtggaaaaatgggaattgctattgcacaaaaggcc
gcagaagctggagcacaggtaaaactgatttatggtaatgttacaattcctcttcctaag
gcaaacaatattgaattaattcatgcatcaagcagtgaggcaatgctcaaggctgttgaa
gataaatttcagcatgcagatgttttaatcatggctgctgccgtggcagattggcgaatg
gaaaaagttgccgatcacaagttaaagaagaatcctgagcaagatacgttatctttaact
ttagtaaaaactaaagatattttgcatgaagtttctagtcataagaaggctaaccaagta
gtagttggctttgcagctgaaacaaatgatttgcttaaaaatgcagaaaagaagctaaag
aacaaaggagcagacatgattgtggccaatgacgtttcaaataatgtttttggcaatgat
aaagatcaagtcgttattttgcaaaacaatacaaagatagaaaaatggccattgatgact
aaacaggaaattgcagtagctttaataaaaaagatagctaataaattaaaatga

DBGET integrated database retrieval system