KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_09970Help
Entry
JL58_09970        CDS       T03401                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Brite
KEGG Orthology (KO) [BR:lia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lia03009]
    JL58_09970
Enzymes [BR:lia01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     JL58_09970
Ribosome biogenesis [BR:lia03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    JL58_09970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_32 Methyltransf_12 PhnA_Zn_Ribbon MetW
Motif
Other DBs
NCBI-ProteinID: AIS60278
UniProt: A0A097B6H7
Position
complement(2069509..2070387)
Genome map
AA seq 292 aa AA seqDB search
MLSKMEINKLAMIESISLLACPICGGEFVFKEPHSFVCPEQHGFDIAKPGYLHLLKQAHK
TKYDQTLFESRKKVIASGFFEKLIERMTNIIIANTEKPALVLYDAGCGEGSHLARVAKEL
EVGGQSIQAVGLDIAKEGVKQAARDYPGIVWTVADLANCPNQLETADVILNILSPSNYEE
FNRLLKKDGFLLKVVPEENYLRELREFIYVDEKSSYSNESVMSRLAEKLTVEQVERITYK
APIAKTLFVDFLEMTPLGWHIGAEKKRHLLANPPQELTVDLQIIIARRAPLL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcaaaaatggagataaataagcttgctatgatagaaagtatctcacttcttgct
tgtccaatttgtggcggtgaatttgtttttaaagagccacactcatttgtctgcccagaa
cagcatggatttgatattgccaagccagggtacttacatttactcaagcaagcacataag
accaagtatgatcaaactttgtttgaatcacgtaaaaaagtgattgcgagcgggtttttt
gagaagttaattgaacggatgacaaatattattatcgcgaatacagaaaaaccagcactc
gttttatatgatgctggttgtggtgaaggaagtcatttagcacgagtggcaaaggagctt
gaagtaggaggacagtccatacaagctgtgggattagatattgcaaaagaaggtgttaaa
caagctgcgcgtgactatccgggaatagtttggacggtagcagacctagccaactgtcct
aatcaattagagacagcagatgtgattttaaatattttatcaccttcgaattatgaggaa
tttaatcggttactaaaaaaagatggctttttacttaaagtagttccagaagagaattat
ttacgcgaattgcgcgaatttatttatgtcgatgagaaaagtagctattcaaatgagtca
gtaatgtctcgactagcggaaaaactaacggtcgaacaggtggaacgaataacttataaa
gcgccaatcgccaaaacattatttgtggattttcttgaaatgacaccacttggttggcac
attggtgcagagaaaaaacgtcatttattagcaaatccgccgcaagagctaaccgtggat
ctgcaaatcattattgcaagaagagcaccacttttgtaa

DBGET integrated database retrieval system