KEGG   Legionella israelensis: E4T55_02435Help
Entry
E4T55_02435       CDS       T05938                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
lib  Legionella israelensis
Brite
KEGG Orthology (KO) [BR:lib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E4T55_02435
Enzymes [BR:lib01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     E4T55_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QBS08816
Position
complement(564612..565421)
Genome map
AA seq 269 aa AA seqDB search
MARIAIAQMTSLPRVEDNMTLVEQLIAQAHEQGAELIVLPENFALMGKKETDKSDIVEVF
GHGPIQDKISQLAKQFTIWVIAGTLPIKGEGRRVRASSLVYDQSGHCVARYDKIHLFDVR
VSEHEAHKESSSIEPGNNVVVVDTPVGKIGLSVCYDLRFPELYQQLVLKGAELFTIPSAF
TATTGLAHWEVLLKARAIENLSYVVAPNQSGEHENGRQTYGHSMIIDPWGRTLTELETEM
GVLSADIDLNWLHKLRKQFPCNDHHVLSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaatcgcaatcgcccaaatgacttctttaccacgagtagaagataatatgact
ttggttgaacaattaattgcccaagctcatgagcaaggagcagaacttattgttttgcct
gaaaattttgctctcatgggcaaaaaagaaaccgataagtcagacatagtggaagtcttt
ggtcatgggcctatacaagataaaataagtcagctggcaaagcagtttaccatctgggtt
atagctggcacattgcccattaaaggtgaaggcaggcgggtacgtgccagttcattagtg
tatgatcaaagcggtcattgcgtagcacgctatgataagattcatctttttgatgtaagg
gtgtcggaacatgaggcgcacaaggaatcttcatcaatagagcctggaaataatgtggtg
gttgtggatacacctgtaggaaaaattggtctgagtgtttgttatgacttgcgttttccg
gaattatatcaacaattagtattaaaaggtgcagaattattcaccataccttcagcgttt
acagcaacaactggtttagcacactgggaggttttgttaaaggcgcgtgccattgaaaat
ctgagttatgtggtggcgccaaaccagagtggcgagcatgagaatggtcgtcaaacctat
ggtcatagtatgataattgacccctgggggagaacactaacagagcttgaaactgaaatg
ggtgtgctttctgcagatattgatttaaactggttacataagctcaggaaacagtttcct
tgtaatgatcatcatgtattaagcaggtaa

DBGET integrated database retrieval system