KEGG   Legionella israelensis: E4T55_12660Help
Entry
E4T55_12660       CDS       T05938                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lib  Legionella israelensis
Pathway
lib00790  Folate biosynthesis
lib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lib00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    E4T55_12660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lib04147]
    E4T55_12660
Enzymes [BR:lib01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     E4T55_12660
Exosome [BR:lib04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E4T55_12660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: QBS10616
Position
complement(2754349..2754690)
Genome map
AA seq 113 aa AA seqDB search
MSSDLSSKHCESCEGIGSALNKEQIENLLPQLDKKWGVTADQKKLKRSFSFKNFYETMAF
VNALAWIANVENHHPDLEVGYNYCHVSFMTHALNGLTQNDFICAAKTDKLLAD
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgatttgagcagcaagcattgcgaatcttgcgaagggattggttcagctctt
aacaaggagcaaattgaaaatttattaccacaactggataaaaaatggggagtaacggcg
gatcaaaaaaagctaaagcgctctttctctttcaaaaatttttatgaaaccatggctttt
gtgaacgccttagcgtggatagctaacgttgagaatcaccatcccgacctggaagtcggc
tataattattgccatgtcagttttatgacgcatgccttaaatggtctaacccaaaatgat
tttatctgcgctgccaagacagataagttattagctgattag

DBGET integrated database retrieval system