KEGG   Leptospira interrogans serovar Copenhageni: LIC_10045Help
Entry
LIC_10045         CDS       T00166                                 

Definition
(GenBank) dTDP-glucose 4-6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
lic00520  Amino sugar and nucleotide sugar metabolism
lic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LIC_10045
Enzymes [BR:lic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     LIC_10045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short KR adh_short_C2 TrkA_N NmrA Sacchrp_dh_NADP NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AAS68682
UniProt: Q72W92
Position
I:55247..56185
Genome map
AA seq 312 aa AA seqDB search
MKKQRILITGGAGFIGSHLCERLLKEGNEVICLDNLHTGRKKNIQKLLNDSKFEFIRHDV
TDPIKLEVDQIYNMACPASPVHYQSNAIKTIKTNVLGMMNMLGLAKRVGARILQASTSEV
YGNPLEHPQKETYWGNVNPIGIRSCYDEGKRVAETLCFDYQRNHKVDIRVIRIFNTYGPR
MLPDDGRVVSNFIVQALKKENITLYGDGDQTRSFCYVDDLVEGIVRMMNTENFNGPVNLG
NDGEFTVRELAELVLKETGSSSKIVHKPLPQDDPARRKPDLTLAKQQLGFEPKVSLVEGI
RKTIEYFKNNLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatattgatcacagggggggctgggtttatcggttctcatctgtgt
gaaaggcttttgaaagaaggcaacgaagttatctgtttagacaacttgcatactggaaga
aagaagaacattcaaaaactcttaaatgattctaagttcgaatttatcagacacgatgta
actgatcccatcaaacttgaagtagatcagatttataatatggcttgtcctgcaagtccg
gtgcattatcaatcaaacgcgatcaaaacgatcaaaacaaacgttttaggaatgatgaat
atgctcggtcttgcaaaaagagtaggggcaagaattcttcaagcttctaccagcgaagtt
tacggaaatccactagaacatcctcaaaaagaaacgtattggggaaacgtaaacccgatc
ggaatcagaagttgttatgacgaaggaaagagagtcgctgaaactctttgtttcgattat
cagagaaatcataaggttgatattcgggtaattcgaatttttaacacatacggtcctaga
atgttaccagacgatggaagagtggttagtaatttcatcgttcaggctctaaaaaaagaa
aacataacattgtacggagatggagatcaaacacgttctttttgttatgtggatgattta
gtagaagggatcgttcggatgatgaacaccgaaaatttcaatgggccagtaaatctagga
aacgacggagaatttacagttcgtgaattagcggagttggttttaaaagaaactggttct
tcttctaaaatcgttcataagccgctacctcaagatgatccagcgcgtagaaaaccagat
ttgactcttgccaaacaacaacttggatttgaaccgaaagtttctcttgtggaaggaatt
cggaaaaccatcgaatactttaaaaataacttggattaa

DBGET integrated database retrieval system