KEGG   Leptospira interrogans serovar Copenhageni: LIC_10549Help
Entry
LIC_10549         CDS       T00166                                 

Definition
(GenBank) xanthosine triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
lic00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:lic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LIC_10549
Enzymes [BR:lic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     LIC_10549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAS69170
UniProt: Q72UV8
Position
I:complement(672486..673079)
Genome map
AA seq 197 aa AA seqDB search
MKRQLALGTNNLNKVKEVSSILMELGIQILTPKDLKVSFNPEETGSTFKENALIKAKELF
YLTKIPSIADDSGICVSALKDEPGVYSARFGGPELNDEGRALLLLEKLKGNQNRKAYYAC
AIAYVDESTEQSFEGRCEGLISEEYDRIGIYGFGYDPIFIFPPLQKPFSQIQEETKNSVS
HRKKALDELLKFLKTKP
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgacaactcgctctcggcacaaacaacttaaacaaagtaaaagaagtaagctcc
attctcatggagttaggaattcagatccttacgcctaaggatctgaaagtttcttttaac
cctgaagaaacaggttctacatttaaagaaaacgctctcatcaaagcgaaagaattgttt
tatttaactaaaattccttcaattgcggatgactctggaatttgtgtttctgctctcaaa
gatgaacctggggtttattcggctcgatttggaggtccggaactgaatgatgaaggtaga
gcacttcttcttttagaaaaactgaaagggaatcaaaatcgcaaggcctattatgcttgt
gcgatcgcttatgtggacgaatctactgaacaaagtttcgaaggtagatgtgaaggattg
atctcagaagaatatgatagaattggaatatatggttttggatacgatccaattttcatt
ttcccgccgcttcaaaaacctttttcacaaatccaagaagaaacaaagaactcagtctct
catagaaaaaaagccttagacgagcttttgaaatttcttaaaacgaaaccataa

DBGET integrated database retrieval system