KEGG   Leptospira interrogans serovar Copenhageni: LIC_12685Help
Entry
LIC_12685         CDS       T00166                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease v alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
lic03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LIC_12685 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lic03400]
    LIC_12685 (recD)
Enzymes [BR:lic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LIC_12685 (recD)
DNA repair and recombination proteins [BR:lic03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LIC_12685 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD AAA_22 UvrD_C SH3_13 AAA_12 UvrD-helicase T2SSE DEAD DUF2075 ResIII AAA CbiA AAA_28 NTPase_1 AAA_16 PhoH
Motif
Other DBs
NCBI-ProteinID: AAS71244
UniProt: Q72NZ2
Position
I:complement(3255040..3256893)
Genome map
AA seq 617 aa AA seqDB search
MGEIELIFIEKLRTDILELIQSSEFEKKKLIKVSEEDSNYILEILNSIWEATQEGSLCVP
VKQEWKKILKIKLPGLVVDRFENTEWVYFEKTYRSKIELERLLKERIENDVSVNVDTDRV
EKILKDLESKSFSLKKNQKKTIFSCLNSSFQIISGGPGTGKTTIVAFLLQILNELKQLPS
PEKIALVAPTGRAAQRLTESVQENLKKISTSLENGFLRGQTIHGLLNYKQSLGGFYYNRE
RYLPHRLIIVDEVSMVDLDLMLSLWNSIPKNETIQEGTIPFRFILIGDPHQLPSVEKGAV
LSDFLSVLESKRFHFVSKLEESNRQQPNTNGEVSKIVTLAEEILKYSPENLNLGTKIDES
FPKTNQIKENILYKSEVVWLQNIESSTSDYFSRDELVEKLWKEIFYPQIDRISSWKIQDS
FCFDKPDFIQKFQEELKRFRCLTIFRSGYWGVDAIQTKIMNLAAQNLFFGKGGNFFAKRL
SKGIYFVGLPILITRNDKSRKLFNGDIGIVLKTESTGELRAVFPIEGKLFQFALDTLPEH
EPAFVMSVHKSQGSEYDTILIYLPDSIEEEKSNGLLNRQVLYTAITRAKKQVILAGNPQT
WEIGIANFQNRNTGFRI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaatcgaattgatttttattgaaaaactaaggacggatattttagaactgatt
cagtcatcggaattcgaaaagaaaaaattaataaaagtatcagaagaggactctaattat
atattagaaatattgaattcaatttgggaggctactcaggaaggaagtttatgtgttcct
gtaaaacaagaatggaagaaaattttaaaaataaagctccccggtcttgtcgtagatcgg
tttgaaaatacggaatgggtgtattttgaaaaaacgtatcgttctaaaattgaattggaa
cgtcttttaaaagaaagaatcgaaaatgatgtttcggttaatgtggatacggatcgagtt
gaaaaaattctaaaggatctggaatcgaaaagtttttcactgaaaaaaaatcaaaaaaaa
acaatcttttcttgtttaaactcctctttccaaattataagtggaggacctggtactgga
aaaacaaccatagtagcgtttttattacaaattttgaatgaactaaagcaacttccttct
ccagaaaaaattgcacttgttgcaccgactggaagggcggctcagaggttaacggaatcg
gttcaagaaaatttaaaaaaaatctccacgtctctcgaaaatggatttctaagaggacaa
acgattcacggacttttaaactacaaacagtcgttaggtgggttttattataatcgagaa
agataccttccacatagactaattatcgtggacgaagtttctatggtagatttagatctg
atgctttctctttggaattcaattcctaaaaatgagacgattcaagaaggaaccattccg
tttcggtttatattgattggagatccacatcaacttccttctgtagaaaaaggtgccgtg
ttaagcgattttttatccgtgttagaatctaaacgatttcattttgtttctaaattagaa
gaaagtaatcgtcagcaaccaaatacaaacggagaagtttcaaagatagtcacactcgca
gaagaaattttaaaatattctcctgaaaatctaaacttaggaactaagatagatgaaagt
tttccaaaaacgaatcaaattaaagagaatattttatacaaaagtgaagttgtatggttg
caaaatattgaaagtagcacttccgattatttttctagagatgagttagttgaaaaactt
tggaaagaaattttttatcctcaaattgatagaatctcttcttggaaaattcaggattct
ttttgttttgataaaccagattttattcaaaaatttcaagaggaactaaaacgatttcgt
tgtcttacgatttttaggagtggctattggggagtggatgcgattcaaacaaagatcatg
aatttggctgctcaaaatcttttttttggaaagggcgggaacttttttgccaaacgactt
tccaagggaatttattttgtaggtcttcccattttaattactcgaaacgataaaagtaga
aaactttttaacggagatattggaatcgtattaaaaacggaatctaccggagaacttagg
gcggtgtttccgattgaaggaaaactttttcagtttgcgttagacactcttccagagcat
gaacctgcgtttgtaatgagtgtacataaaagtcagggatcagaatatgatacaatccta
atttatcttccagattctatagaagaggaaaaatctaatgggttactcaatcgtcaagtt
ctttatacagcaattacaagagctaaaaaacaagtgatcttggctggaaatccgcaaacc
tgggaaattggaatcgccaattttcaaaatagaaatactgggtttagaatttaa

DBGET integrated database retrieval system