KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1149Help
Entry
LIF_A1149         CDS       T01983                                 

Gene name
nagC
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00010  Glycolysis / Gluconeogenesis
lie00052  Galactose metabolism
lie00500  Starch and sucrose metabolism
lie00520  Amino sugar and nucleotide sugar metabolism
lie00521  Streptomycin biosynthesis
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01120  Microbial metabolism in diverse environments
lie01130  Biosynthesis of antibiotics
lie01200  Carbon metabolism
Module
lie_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lie_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIF_A1149 (nagC)
   00052 Galactose metabolism
    LIF_A1149 (nagC)
   00500 Starch and sucrose metabolism
    LIF_A1149 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    LIF_A1149 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LIF_A1149 (nagC)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LIF_A1149 (nagC)
Enzymes [BR:lie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LIF_A1149 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DEDD_Tnp_IS110 FGGY_N SpoVAE Glucokinase
Motif
Other DBs
NCBI-ProteinID: AER01949
Position
1:complement(1437577..1438473)
Genome map
AA seq 298 aa AA seqDB search
MKSFLGIDIGAGSIKASLIDSNGNVLKSSFRKTGAETNEKQFLDSICDIVSEMKNSSLTA
VGIGSPGPIDSENGILIESANLPLLKNVTLVSHLKEKFSIPVYYNNDANLAALGEYHFGL
GKGSPNLVILTLGTGLGGGWVYQGKLFNGYKGSGMEAGHVTYLPNGSLCGCGQRGCTEAY
FSASGFLNRYKEKTGEVLDSAEEFFEKTRKGDKTASILLNEGIDALAQLCRNLIHTINPE
KIVFTGGLVKSWDLFGDSLQNRIRELIFPIFRTYTQILPGGNVSGTLGAAALCMENLE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctttcttggaatcgatataggtgcaggaagtatcaaagcaagtctcatcgat
tccaacggaaacgtactgaaaagttctttccgtaaaaccggcgcggaaacaaacgaaaaa
caattcctagattctatttgtgacatcgtatcagaaatgaaaaactcttctttaacggcg
gtgggcataggaagcccagggccaatcgattctgaaaacggaattttgatcgagtccgct
aatcttcctcttttaaaaaatgtgacgttagtctctcatttaaaagaaaaattttctatt
ccagtatattataataatgatgcaaaccttgctgcgttgggagaataccatttcggttta
ggaaaaggatcgcctaatttggtaattttaaccttaggaaccggattaggaggtggttgg
gtatatcaaggaaaactttttaacggttacaaaggaagtggaatggaagcgggacacgtt
acgtatcttccaaacggctctctatgcggttgtggtcaaagaggttgcaccgaagcttat
tttagcgccagcggatttttaaatcgatataaagaaaagaccggagaagttttagattcc
gcagaagaattctttgaaaaaactagaaaaggagataaaaccgcatcgattttgttaaac
gaaggtattgacgcgcttgcacaactttgtagaaatctaattcatacaatcaacccggag
aaaattgtttttacaggaggacttgtaaagtcctgggatttattcggtgattccctacaa
aatagaatccgggaactgatctttccaattttcagaacttatactcaaatcctccccgga
ggaaacgtatccggcacattaggcgctgcggcgctttgtatggagaatttagaatga

DBGET integrated database retrieval system