KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B008Help
Entry
LIF_B008          CDS       T01983                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00860  Porphyrin and chlorophyll metabolism
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIF_B008 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lie01007]
    LIF_B008 (hemL)
Enzymes [BR:lie01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LIF_B008 (hemL)
Amino acid related enzymes [BR:lie01007]
 Aminotransferase (transaminase)
  Class III
   LIF_B008 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AER04251
Position
2:9810..11141
Genome map
AA seq 443 aa AA seqDB search
MNQNKPTSKLISDFWKGKTSEELFERAKKVSPGGVHSPVRSFRSVGGTPVFFASAKGATL
TDISGKEYIDYCLSFGPLILGHRDPEVEEVVRETTEIAWSFGAAEPYSLELAELISSRVP
WAEKVRFVNSGTEAVMSALRVARAATGREKILKFDGCYHGHLDSLLVKAGSGLAGESSSD
SAGISATSIANTLVLPLDDEASVERVFETEGKNIAALIIEPLPANYGLLIQRKEFLLKIV
ETARKYGTLVVFDEVISGFRVGFQGMSGLLGIWPDLVTYGKIIGGGFPVGCYAGKKDLLD
LVAPSGPVYQAGTLSANPFGMRAGLATLKKVQRDSIYSVLDDRTKIFTDTMTKLLNKKSN
QEWEAVIHSSLFWFRKKTQQPIRRIDLIPEGHKESFAKVFHTFLKNGIYLAPSGYEVGFL
SWAHDDEIIAKTLEIADKALKTF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccagaacaaaccaacttctaaattgatttccgatttttggaaagggaaaacctct
gaagaactttttgaaagagcaaaaaaagtttctcccggaggtgttcattctccagttcgt
tcttttcgctcagtgggggggacgcccgtattttttgcttctgcaaaaggggctacgtta
accgacatatctggtaaagaatatattgattattgtctgagttttggccctttgatttta
ggtcacagagatccagaagtagaagaagtggttcgtgaaaccactgaaattgcctggagt
tttggggctgcagaaccctactctctcgaattggcggaattgatttcaagtcgagttcct
tgggcggagaaggttcgttttgtaaattcaggaacggaagcagtgatgagtgcgcttcgt
gttgcacgagctgctactggaagggaaaaaattctaaaatttgacggatgttatcacggt
catttagactctcttcttgtaaaggctggttccggacttgcaggagaatcttcttctgat
agcgctgggatttccgcaacatcaatcgcaaatactttagtgttgcctttggatgatgag
gcttctgtagaaagagtttttgaaacagaaggaaaaaatatagccgctttgattatagag
cctcttccggctaattatggtttgttgattcaaagaaaagagtttcttttaaagatcgta
gaaaccgccagaaaatatgggacgttagtcgtatttgatgaggtgatttccggatttagg
gtcggttttcaaggaatgtctggtttactcggtatttggcctgatttggtgacgtatggt
aaaattataggcggaggatttcctgtaggttgttatgcgggtaaaaaagaccttttggat
ctggttgctccttctggtccagtttaccaagcaggtaccttaagcgcaaatccgtttgga
atgagggccggtcttgccactttaaaaaaagtacaaagagactccatttattcagtgtta
gatgatagaaccaaaatttttacggatacaatgaccaaacttctaaacaaaaaatcgaat
caagaatgggaagccgtaattcattcttctttattttggtttcggaaaaaaacacaacaa
cccatacgtagaattgatctgattccagaaggacataaggaaagttttgcaaaagtattt
catacttttctaaaaaacggaatttatcttgctccttccggttacgaagtagggttttta
tcttgggcacatgatgatgaaattatagcaaaaactttagagatagcggataaggctctc
aaaacgttctaa

DBGET integrated database retrieval system