KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B012Help
Entry
LIF_B012          CDS       T01983                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen 3 oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00860  Porphyrin and chlorophyll metabolism
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIF_B012 (hemN)
Enzymes [BR:lie01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     LIF_B012 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM UN_NPL4 DUF2517 HTH_45 DUF493
Motif
Other DBs
NCBI-ProteinID: AER04255
Position
2:13756..15105
Genome map
AA seq 449 aa AA seqDB search
MTTVKDLIAKYDIPAPRYTSYPTVPYWSENPTTEEWLEKVRNRLRFENTSLSLYLHIPFC
ETLCSFCGCNTSITKNHSVEDPYIESILLEFSNYLKEVPEIAKRELKELHLGGGTPTYLS
EKNLEILLDSILKKMNLSSKYEFSLEVDPRRTRDTQLKILRDFGFKRISLGVQDFDPEVQ
RLVNRTQPFEMTERITELSRKLGYTSVNFDLIYGLPKQNLQNMKRTIKKTLELRPDRIAF
YSYAHVPWLKASQRLFTEVDLPSGSAKRELYEVSREMFLKAGYIEIGMDHFALESDSLFQ
AVKNGNLHRNFMGYTAKTTDMLLGLGVSAISDSWDCFHQNEKIVKKYQKRIYSEGFATLR
GHKLNEEDLIQRSLILQLSTSGKVIVPEEILREVRLYLASMEDDTLVRWEGNLLSLTEKG
RPFLRNVCTSLDLRLRRKSPELRVFSSSI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgactactgtgaaagatttgattgcaaagtatgatattcccgcgcctagatatactagt
tatcctactgtgccgtattggtccgaaaatccaaccacggaagaatggttagaaaaggta
agaaatcgtcttcgtttcgaaaatacatcgctttctttatatttgcacataccgttttgt
gaaaccctttgttctttttgcggttgtaatacttcgatcacaaaaaatcattccgtggaa
gatccgtatatagaatctattctattagaattttctaattatttaaaagaggtgccagaa
atagcaaaaagggagctaaaagaactccatctagggggaggaacgcctacttacttatcg
gagaagaatttggaaattcttttggattcaatattaaaaaaaatgaatctgtcttccaaa
tacgagttttctcttgaagtagaccctcgcagaaccagagatacacaactcaaaatctta
cgtgatttcggttttaaaagaatcagtttaggagttcaagattttgatccggaagtgcag
agattggtcaaccgtactcaacctttcgaaatgacggagagaattactgaactttccaga
aaattaggatatacttccgtaaacttcgatctgatttacggacttccaaaacaaaatctg
caaaacatgaaacgcactataaaaaaaactttagagttacgtccggatagaattgcgttc
tacagttacgcacacgttccttggcttaaagcgtctcaaagattgtttacggaagtggat
ctgccttccggttccgcaaaacgagagttatatgaagtttctagagaaatgtttttaaaa
gcgggttatatcgaaattggaatggatcattttgcgttggaatcggattcactttttcag
gcggtaaaaaacggaaatctacaccgaaactttatgggatacactgctaaaacaacggat
atgcttttggggcttggagtttccgcaatttcggatagttgggattgttttcatcaaaac
gaaaaaattgtcaaaaaatatcagaaacggatttactccgaaggattcgctacacttcgg
ggacataagttaaacgaggaagatctgatacaaaggtctttgattttgcaattgtcgacc
agtggaaaggttatagtaccggaggaaattttgagagaagtgaggctgtatttggcctct
atggaagacgatactttagtcagatgggaaggaaatcttctctctttgaccgaaaaaggt
aggccttttcttaggaatgtttgtacaagtttggatttgaggttgcgcagaaaaagtcct
gaattgagggttttttcaagttcgatttga

DBGET integrated database retrieval system