KEGG   Leishmania infantum: LINJ_01_0800Help
Entry
LINJ_01_0800      CDS       T01112                                 

Definition
(RefSeq) putative eukaryotic initiation factor 4a
  KO
K03257  translation initiation factor 4A
Organism
lif  Leishmania infantum
Pathway
lif03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lif00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    LINJ_01_0800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lif03019]
    LINJ_01_0800
   03012 Translation factors [BR:lif03012]
    LINJ_01_0800
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lif04147]
    LINJ_01_0800
Messenger RNA biogenesis [BR:lif03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LINJ_01_0800
   mRNA cycle factors
    Stress granule specific factors
     LINJ_01_0800
Translation factors [BR:lif03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    LINJ_01_0800
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_01_0800
  Exosomal proteins of bladder cancer cells
   LINJ_01_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C CMS1 AAA_22
Motif
Other DBs
NCBI-GeneID: 5066116
NCBI-ProteinID: XP_001462693
UniProt: A4HRK0
Position
1:242414..243625
Genome map
AA seq 403 aa AA seqDB search
MAQNDKIAPQDQDSFLDDQPGVRPIPSFDDMPLHQNLLRGIYSYGFEKPSSIQQRAIAPF
TRGGDIIAQAQSGTGKTGAFSIGLLQRLDFRHNLIQGLVLSPTRELALQTAEVISRIGEF
LSNSSKFCETFVGGTRVQDDLRKLQAGVIVAVGTPGRVSDVIKRGALRTESLRVLVLDEA
DEMLSQGFADQIYEIFRFLPKDIQVALFSATMPEEVLELTKKFMRDPVRILVKRESLTLE
GIKQFFIAVEEEHKLDTLMDLYETVSIAQSVIFANTRRKVDWIAEKLNQSNHTVSSMHAE
MPKSDRERVMNTFRSGSSRVLVTTDLVARGIDVHHVNIVINFDLPTNKENYLHRIGRGGR
YGRKGVAINFVTEKDVELLHEIEAHYHTQIDELPVDFAAYLGE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaatgataagatcgccccccaggaccaggactccttcctcgatgaccagccc
ggcgttcgcccgatcccgtccttcgacgacatgccgctgcaccagaacctgctgcgcggc
atctactcgtacgggttcgagaagccgtccagcatccagcagcgcgcgatagcccccttc
acgcgcggcggcgacatcatcgcgcaggcccagtccggtaccggcaagacgggtgccttc
tccatcggtctgctgcagcgcctggacttccgccacaacctgatccagggcctcgtgctc
tcccccactcgcgagctggccctgcagacggcggaggtgatcagccgcatcggtgagttc
ctgtcgaacagctccaagttctgcgagacctttgtcggcggcacgcgcgtgcaggatgac
ctgcgcaagctgcaggccggcgtcatcgttgccgtgggcacgccgggccgcgtgtccgac
gtgatcaagcgcggcgcgctgcgcacggagtcgctgcgcgtgctggtgctcgacgaggct
gatgagatgctgtctcagggcttcgcggaccagatttacgagatcttccgcttcctgccg
aaggacatccaggtcgcgctcttctccgccacgatgccggaggaggtgctggagctgacg
aagaagttcatgcgcgaccccgtgcgcattctcgtgaagcgcgagagcctgacgctggag
ggcatcaagcagttcttcatcgccgtcgaagaggagcacaagctggacacgctgatggac
ctgtacgagaccgtgtccatcgcgcagtccgtcatcttcgccaacacgcgccgcaaggtg
gactggatcgccgagaagctgaaccagagcaaccacaccgtcagcagcatgcacgccgag
atgcccaagagcgaccgcgagcgcgtcatgaacaccttccgcagcggcagctcccgcgtg
ctcgtcacgaccgacctcgtggcgcgcggtatcgacgtgcaccacgtgaacatcgtcatc
aacttcgacctgccaacgaacaaggagaactacctgcatcgcattggccgcggcggccgc
tacggccgtaagggtgttgccatcaacttcgtgacggagaaggacgtggagctgctgcac
gagatcgaggcgcactaccacacgcagatcgacgagctcccggtcgacttcgctgcctac
cttggcgagtaa

DBGET integrated database retrieval system