KEGG   Leishmania infantum: LINJ_03_0190Help
Entry
LINJ_03_0190      CDS       T01112                                 

Definition
(RefSeq) putative delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
lif  Leishmania infantum
Pathway
lif00250  Alanine, aspartate and glutamate metabolism
lif00330  Arginine and proline metabolism
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LINJ_03_0190
   00330 Arginine and proline metabolism
    LINJ_03_0190
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     LINJ_03_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 5066259
NCBI-ProteinID: XP_001462773
UniProt: A4HRT1
Position
3:50496..52178
Genome map
AA seq 560 aa AA seqDB search
MLRRTVSWAFAAFKCPPVLNEPMDNFEPGSASAKGTLEACKAARGEVRDCPIMIGGKPYT
SSNIIKGIMPSDHQVQIAKAYNATPELARKAVEAAVEASKEWSQVPFRDRAAIFYKAAHL
LSTKYRHEMRAVTMLGQSKNPWQAEIDCVAEACDFIRWNIHFAEELYAQQPRSVSNSGVW
NTTDYRPLEGFVSAITPFNFTAIAANLAGTPALMGNTVVWKPSPTAVLSNYLMYKIMEEA
GLPAGVINFVPCEPAVMDSAVNADPRLAAVVFTGSTRVFTEINKNVFSRLETYHNFPRIS
GETGGKDFHLVHPSADMKHVAAGTVRGAFEFQGQKCSACSRLYAPKTCWKELKALLIKGQ
KQIKMGQPDDFQSFMCAVIDETSFNKNKKYIEIAKADSSNYEVVVGGKCDKTRGYFVEPT
IIETKDPRAQLMREEIFGPVLTVFVYDDSKPGYWKEVCELVDSTTKYGLTGAVFSRERAP
IREADKYLRYAAGNYYVNDKCTGAVVGQQPFGGSRLSGSNDKPGAGQFVTRFVSARSIKE
SFDVTPTISYPHQLPDVYTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgcaccgtgtcctgggccttcgcggccttcaagtgcccacctgtgctgaat
gagcccatggacaacttcgagccgggctccgcctctgcgaaggggacgctggaggcctgc
aaggcggctcgcggggaggtgcgggattgcccaatcatgattggcggcaagccgtacacc
tcctcgaacatcatcaagggcattatgccctcggatcaccaagtgcagattgccaaggcc
tacaacgcaacgccggagctcgcgaggaaggctgtggaggcggctgtggaggcctccaag
gagtggagccaggtgcccttccgcgaccgtgcggccatcttctacaaggcggcacacctc
ctgtcaaccaaataccgccacgagatgcgcgccgtgacgatgctgggccagagcaagaat
ccgtggcaggcggagatcgactgcgtcgccgaggcctgtgacttcatccgctggaacatc
cactttgctgaggagctgtacgcacagcagccgcgctccgtctcgaacagcggcgtgtgg
aacacgacggactaccgtccgctcgaggggtttgtgtcggccatcacgcccttcaacttc
acggccatcgccgcgaatctcgctggcacgccggcgctgatgggcaacacggtggtctgg
aagccgagcccgacggcggtgctctcgaactacctcatgtacaagattatggaggaggcg
gggctgccggctggcgtcatcaactttgtgccgtgcgagccagcggtgatggacagcgcc
gtgaatgccgacccgcgcctcgccgccgtcgtcttcaccggctcgacccgcgtctttacc
gaaatcaacaagaacgtcttcagccgcctcgagacgtaccacaactttccgcgcatctcc
ggcgagacgggcggcaaggacttccacctcgtccacccctctgccgacatgaagcacgtg
gcagccggcaccgtccgtggcgctttcgagttccaagggcagaaatgcagcgcgtgctcg
cggctgtacgcgccaaagacctgctggaaggagttgaaggcattgctcatcaagggccag
aagcagatcaagatgggccagccggacgacttccagagcttcatgtgcgccgtcatcgac
gagacgtccttcaacaagaataagaagtacatcgaaatcgccaaggcggactcgagcaac
tacgaggtcgttgtgggaggcaagtgcgacaagacgagggggtacttcgttgagccgacc
atcattgagacgaaggacccccgcgcgcagctcatgcgcgaggagatatttggccctgtg
ctgacggtgtttgtgtatgacgacagtaagccggggtactggaaagaagtgtgcgagctc
gtcgactcgaccacgaagtacggcctgaccggtgccgtcttctctcgcgagcgtgcgccg
atcagggaggcggacaagtacctgcgctacgcggcgggcaactactatgtgaacgacaag
tgcaccggcgctgtcgttggccagcagccgttcggcggctcgcgcctgagcggctcgaat
gacaagccgggtgccggccagttcgtcacccgcttcgtctcggcccgctccatcaaggag
agcttcgacgtgacgcccaccatctcgtacccgcaccagctgcccgatgtgtacacgctg
tag

DBGET integrated database retrieval system