KEGG   Leishmania infantum: LINJ_05_0960Help
Entry
LINJ_05_0960      CDS       T01112                                 

Definition
(RefSeq) metallo-peptidase, Clan M-, Family M49
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
lif  Leishmania infantum
Brite
KEGG Orthology (KO) [BR:lif00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lif01002]
    LINJ_05_0960
Enzymes [BR:lif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     LINJ_05_0960
Peptidases [BR:lif01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   LINJ_05_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 5066454
NCBI-ProteinID: XP_001463059
UniProt: A4HSL8
Position
5:354919..356958
Genome map
AA seq 679 aa AA seqDB search
MSHNALYTTPRAVPYCTLAIANAFKDLTPKQRHYAHHMMAAGWCGAPVVAEQVSPESLPL
LRFFFQVLSAQPLDTFKANSVNAGVDPDEVNQFLEYFAMVYSNMGNYLSFGDTKFVPSIP
KERFAKIVASADGSPAVDAQLLDAIYNLDDDKLTLDFPPKGLTRYYSPNVTREDAAVAND
FLASKKMDGVNTRVFKEEDGTLVIRVAAATERTVPAEKFNGRTIAIYYGDYKEEMARVVA
ELRKAQPYAENETEVRMLNHYIEHFQYGDVDVHKESQKEWVKDVGPTVETNIGFIESYRD
PSGVRAEWEGFVAVVNKEQSKMYGALVAQGEKFVAELPWGKAFEKDVFSSPDFTSLDVLG
FASSGIPAGINIPNYDDIRQTVGFKNVYLSNVVSAMTFKDKLNYITEADWELYKASILTA
TSVNVGIHELLGHGTGKLLSENSDGTFNFDEKTVDPISGKPVATWYKPGDTYSSVFGGLG
SSYEECRAEAVSLYLCLLPDLLEIFNLQTTKEQQDVIYVCWLNMVRAGLVGLEFYTPEKQ
QWRQAHMRARFCILQALARAPNPIVQITENAKEGVLITLDRERIATDGRQAIGDLLVNLN
VNKATADAKRGSAYFENMTVVSDQYVHYRDIIMARRKPRKQYVQPHTFISGDTVEVREFA
GSVEGVVESFVTRHREIPL
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaacgcgctttacactacccctcgtgcggtaccgtactgcaccctggccatc
gccaacgccttcaaggacctgaccccgaagcagcgtcactacgcccatcacatgatggcg
gcggggtggtgcggcgccccggtggtggctgagcaggtgagtcccgagtcactgccgctc
ctgcgtttcttcttccaggtgctcagtgcgcagccgctggacaccttcaaggcgaacagc
gtcaacgccggcgtcgaccccgatgaggtgaaccagttcctggaatacttcgcgatggtc
tactcgaacatgggcaactacctctccttcggcgacaccaagttcgtcccatcgattccg
aaggaacgctttgcgaagatcgtggcgagcgcggacgggtctccggcggtggatgcgcag
ctgctggacgccatctacaacctggacgacgacaagctgacgctggacttccctcccaaa
gggcttacgcggtactacagcccaaacgtcacccgcgaagacgccgctgtcgcgaacgac
ttcctggcgtcgaaaaagatggacggcgtcaacacacgcgtgttcaaggaggaagacggc
accctcgtcatccgcgtcgcggcggcgaccgagaggacggtgccggcggagaagttcaac
ggacgcaccattgcaatttactatggcgactacaaggaggagatggcccgcgtcgtcgcg
gagctgcgcaaggcgcagccgtacgcggagaacgagacggaggtgcgtatgttgaaccac
tacatcgagcacttccagtatggcgacgtggacgtgcacaaggagagccaaaaggagtgg
gtgaaggatgtggggccgacggtggagacgaacatcggcttcatcgagtcgtaccgcgac
ccctccggcgtgcgtgcggagtgggaaggcttcgtggcggtggtgaacaaggagcagtcg
aagatgtacggcgcactggtggcacagggcgagaagttcgttgctgagctgccgtggggc
aaggcgttcgagaaggacgtcttctccagcccggacttcaccagccttgacgtcctgggc
ttcgcgagcagtggcattccggccggcatcaacatccccaactacgacgacattcgccag
accgttggcttcaagaacgtgtacctgtccaacgtggtgagcgcgatgaccttcaaggac
aagctcaactacatcacagaggcggactgggagctgtacaaggcgagcattctcaccgcg
acctcggtgaacgtcggcattcacgagctgctgggccacggcacaggcaagctgctgtcg
gagaacagcgacggcaccttcaattttgacgagaaaacggtggacccaatcagcggcaag
cccgttgccacgtggtacaagcccggcgacacgtattcgagcgtgtttggcggtcttggc
agctcgtacgaggaatgccgcgctgaggcggtatcgctgtacctctgcttgctgccagac
ctgctggagatcttcaacctccagacaacgaaagagcagcaggacgtcatctatgtctgc
tggctgaacatggtgcgcgccggcctggtcgggctcgagttctacaccccggagaagcag
cagtggcgccaggctcacatgcgggcacgtttctgcattctccaggcgctggcgcgtgca
ccgaacccgattgtgcagatcaccgagaacgccaaggagggcgtcctcatcacactcgac
cgcgagcgcatcgccacagacgggcgccaggcgattggggacctgctcgtgaacctcaat
gttaacaaggcgacggccgacgcgaagcgcggcagcgcctactttgagaacatgacggtc
gtgagcgaccagtacgtgcactaccgcgacatcatcatggcgcgccgcaagccgcgcaag
cagtacgtccagccgcacaccttcatcagcggggatacggtggaggtgcgggagtttgcc
ggatcggtagaaggggtcgtggaatccttcgttacccggcaccgcgagatcccgctgtag

DBGET integrated database retrieval system