KEGG   Leishmania infantum: LINJ_16_1390Help
Entry
LINJ_16_1390      CDS       T01112                                 

Definition
(RefSeq) putative cytochrome c
  KO
K08738  cytochrome c
Organism
lif  Leishmania infantum
Brite
KEGG Orthology (KO) [BR:lif00001]
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    LINJ_16_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 5068022
NCBI-ProteinID: XP_001464620
UniProt: A4HX29
Position
16:complement(529770..530111)
Genome map
AA seq 113 aa AA seqDB search
MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGANGVGPNLFGIVHRPSGKVEGFTYS
KANAESGVVWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgcccctctgccgcctggcgacgtggagcgcggcgagaagctg
ttcaagggccgtgctgcccagtgccacaccgccaccaagggcggcgcgaacggtgtgggc
ccgaacctgttcggcatcgtccaccgcccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgagtcaggcgtagtctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcag
gagcgcgctgacgtgatcgcgtacctcgagactctcaagtaa

DBGET integrated database retrieval system