KEGG   Leishmania infantum: LINJ_18_0690Help
Entry
LINJ_18_0690      CDS       T01112                                 

Definition
(RefSeq) putative citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
lif  Leishmania infantum
Pathway
lif00020  Citrate cycle (TCA cycle)
lif00630  Glyoxylate and dicarboxylate metabolism
lif01100  Metabolic pathways
lif01110  Biosynthesis of secondary metabolites
lif01130  Biosynthesis of antibiotics
lif01200  Carbon metabolism
lif01210  2-Oxocarboxylic acid metabolism
lif01230  Biosynthesis of amino acids
Module
lif_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LINJ_18_0690
   00630 Glyoxylate and dicarboxylate metabolism
    LINJ_18_0690
Enzymes [BR:lif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     LINJ_18_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt Cyclin_C zf-AN1
Motif
Other DBs
NCBI-GeneID: 5068291
NCBI-ProteinID: XP_001464885
UniProt: A4HXU4
Position
18:281930..283342
Genome map
AA seq 470 aa AA seqDB search
MRALRCSIIRGVAGLRMASSVLDEMKEQMLRRSKEDHKKIGDLRKKHGHEKLCDATIDAV
YGGMRGITGLVYEPSLLDSAEGIRFRGLTILECQEMLPKAPGGKEPLPEAMFWLLMTGEV
PTEEQARGLNAELHRRVDPEAIAAAQKAIAALPKNAHPMTAFSVGVLALQTYSKFAAAYA
AGKSNKKTYWEYALEDSLDMLARTPAVAAMIYNRETKGQVELAAPSNSDLDWAANFAKML
GFQDEEFRECMRLYLSVHADHEGGNVSAHTTTLVASALSDPYLAFSAGLNGLAGPLHGLA
NQEVLKYLFSMQERVKADGVNVHDEAALEKALTKYTWELLNSGQVVPGYGHAVLRKVDPR
YTCQRNFCLRHNFQDDLFKLVNTIYMIMPGILKEHGKTKNPYPNVDAHSGVLLQHYGLTE
QNYYTVLFGLSRQMGVLAGVVWDRLQGRPLERPKSITTEMLAKKYLCNSL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctcttcgctgctccataattcgcggcgtcgccggtctccgcatggcgtcatcg
gtattggatgagatgaaggaacagatgctgaggcgcagcaaagaagaccataagaagatc
ggcgacctcaggaagaagcacggccatgagaagctgtgcgacgccaccatcgatgcggtg
tacggcggcatgcgtggcatcaccggcctcgtgtacgagccatcactgctggactccgcg
gagggcatccgcttccgcggcctcacgatcctggagtgccaggagatgctgcccaaagcg
ccgggcggcaaggagccgctgccggaggcgatgttctggctgctgatgaccggcgaggtg
ccgacggaggagcaggcaaggggcctgaacgcggagctgcaccgtcgcgtcgaccccgag
gcgattgccgcggcgcagaaggcgatcgcggcgctgccgaagaacgcgcacccgatgacg
gcgttcagtgtgggcgtgcttgcgctgcagacctactcgaagtttgctgcggcttatgcg
gcgggcaagtcgaacaagaagacgtactgggagtacgcgctggaggactcgctggacatg
ctggcgcgcacgccggcggtggcggcgatgatctacaaccgcgagaccaagggccaggtg
gagttggccgcaccgagcaacagcgacctggactgggcggcgaactttgcgaaaatgttg
ggcttccaggacgaggagttccgggagtgcatgcgtctgtacctgtctgtccacgccgac
cacgagggcggaaacgtgtcggcacacacgacgacgctggttgcgtcggcgctgagcgac
ccctacctcgccttcagcgctggcctgaacggtcttgctggcccgctgcatgggctggcg
aaccaggaggtgctgaaatacctgtttagcatgcaggagcgtgtgaaggcggacggcgtg
aacgtgcatgatgaggcagcgctggagaaagcgctgaccaagtacacgtgggagctgctc
aactccggccaggtggtgcccggctacggccacgcggtgctgcgcaaggtggacccgcgc
tacacctgccagcgcaacttctgcctgcgccacaacttccaggacgacctgttcaagctg
gttaacaccatctacatgatcatgcccggcatcctgaaggagcacggcaagaccaagaac
ccctaccccaacgtcgacgcgcactccggcgtgctactgcagcattacggactgacggag
cagaactactacacggtgttgtttggcctgtcgcgccagatgggcgtattggccggcgtc
gtctgggaccgcctgcagggccgcccgctcgagcgtccgaagtcgatcacgacggagatg
ctcgcaaagaaatacctgtgcaactccttgtga

DBGET integrated database retrieval system