KEGG   Leishmania infantum: LINJ_20_1650Help
Entry
LINJ_20_1650      CDS       T01112                                 

Definition
(RefSeq) putative separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
lif  Leishmania infantum
Brite
KEGG Orthology (KO) [BR:lif00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lif01002]
    LINJ_20_1650
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lif03036]
    LINJ_20_1650
Enzymes [BR:lif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     LINJ_20_1650
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C50: separase family
   LINJ_20_1650
Chromosome and associated proteins [BR:lif03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    LINJ_20_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 5068706
NCBI-ProteinID: XP_001465288
UniProt: A4HYZ7
Position
20:complement(692897..696736)
Genome map
AA seq 1279 aa AA seqDB search
MTSSQSALLRTLHDAITHTLRNADEVAALVDAAVQLSSLRYRPLASSWDLPKLLSSALRT
QINTRMRSSAAVASSVSPASLCRVLAAAWRLCPLVTLPLPRAAADGCTSPTSIALLLSLS
DEDVERVGREISSLENAPCSSNAAEPSARDTATAVVTSLLLYWHMLCAEAQEVTAESEET
FRRVSATVWRCLQRWAAADGCDEMRRALLKAWVSTVLRRALLCTSGLCVMSAVTLLDTVV
PPSIDTTTPMAFASCDPSNSGLSELWARLHLRVCQHVMEDMRARQAAFSAEWSRSVVPVL
TRAFAQEPPLLSPSFTNVIQFAEPLDTSLGELMRVVHRMRRCALGSSATSQAVDLASCVS
ADTLAPLLCLARLSRRLAEAGVPIAPFATANTYRAYVAPLIAVSLRWGLVAEACVLLDWF
ASALDDRGTHWQRRLHRILDSLTPDASSATPGNSLTRLHGQEGGLPYFEWLEELQCTSST
ALDVLATCDDVRQLRPVCDALLRHRPAEWATEVLQDPFAPFFILSGVTRLIEALLQARDA
PLARFYVTLLGRLLPRCPCPTQLQVFLRVVHRLATVLTTTHLSAADYAAPDSLYGAALAR
WQRLKTALEHVDAELSDADGADGSRHVDWPRQNTAGLAWDARKHLQCFCAPRRVENVRTA
ASAQITPQSPAVALGTVVVLCYVPAGSQSEGEGLLWLRRTRASATCPSGEQRVQDQQLLS
LTARCPVGGALRSCAAEMADVMNRNRAQLMRGDASAVGETGRCLDSQGSRELAASTSCAC
QQASDGTAAPIETDAQRQRRRKEAWWCERFELDDRIGRVAASMQDALGAAHMLLLGDPSS
SLGGQLQTLAARFACECVRLRGASHCPPVEALQHVTLQVLAAAPYLWKDKTPPRGQTTCW
YGPRNARSCACCMQTVKRAQRMLLEAVTALGQLVTAATAAAMESSLSCALASEPANVEEC
WLALLADRSVQGVVEEMVPAVLNAYYRELTPDAAANAPRDDEERGHHHADLLLVSREHVY
LVLDGELHALPWEALGVCQERSVSRVPSLEYLKYCSTDASAVSLQRLLVYRDDAALQHGP
SSLTDLITQHPHWEVVYGETLQAATAAARDGSSAVTSPLMRRLLSQCEAASDRIDTYVYA
GHKGGEHVAPRGALYDWIPAAAGTPPTLVLLMGCSSARMQASALYDCFGLPFAYLSAGVS
CVLGCLWDVTDADIDRLTGRFLQVASQTTADGEGITVGECLAVARRACKLQYLTGMATVF
YGVNCYVTAAREDNSKGAA
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcccagagtgccctgttgcgcaccctccatgatgccatcacccacaccttg
cgcaatgccgacgaggttgcggcactagtcgacgccgcggtgcaactctcctccttacgc
tatcgacccctcgcatcgtcgtgggatctgccgaaattgctctcgtccgcgttacgcacg
cagatcaacacgcgcatgcgctcgtctgcggcagtggcgagcagcgtcagcccagcctct
ctgtgtcgcgtgctggcagcggcgtggcggctgtgtccgctggtgacgttgccgctgcct
cgtgcagccgccgacggttgcacctcaccgaccagcattgctttgcttctgtcgctcagc
gatgaagacgtggaacgggtgggacgggagatttcgtcgctggagaacgctccgtgttct
tcgaatgcagcagagccgtctgctcgtgacacagcaaccgctgttgtgacgtcgctactg
ctctactggcacatgctctgcgccgaagcgcaggaagtcactgcagagagcgaggaaacg
tttcggcgggtgtcagcgacggtgtggcggtgtctgcagcgctgggccgcggctgacggc
tgtgatgagatgcgccgtgcactcctcaaagcatgggtgagtacagtgctgcggcgcgcg
ctattgtgcacgagtggcttgtgcgtgatgagcgctgtaacgctgttggacaccgtcgtg
ccgccgagcatagacacgacgacgcccatggcttttgcctcgtgcgatccgtcgaacagt
ggactgagcgagctgtgggcaagactgcacctgcgcgtctgccaacacgtcatggaggac
atgcgcgcgcgtcaagccgccttcagcgcagagtggagtcgctccgtcgtgccggtgctc
actcgcgctttcgcgcaggagccacccttgctatccccctccttcaccaacgtgatacag
tttgccgaaccgctcgacacttcgctgggtgagctgatgcgtgtggtccaccgtatgcgg
cggtgcgcgctcggtagcagtgccacatcgcaggcggttgatctcgcctcgtgtgtgagt
gcagataccctggccccgctcttgtgtttggcgcgtctctctcgaagactggccgaagcg
ggtgtaccgattgcgccctttgcgactgccaacacgtatcgcgcatacgtggcgccgtta
atcgcggtgtcgcttcgctggggcctcgttgcagaggcatgtgtgctcctggattggttc
gccagcgcgctggacgatcgtggaacgcattggcagcggcgcctgcatcgaatcctggac
agtcttacaccagacgcgtcctctgcaacgccagggaacagcttgacaagactgcacgga
caagagggcggtctgccatacttcgagtggcttgaagagcttcagtgcacctcctcaacg
gctctggacgtgctggccacttgcgatgatgtcaggcagctgcggccggtatgtgacgcc
cttctgcgccaccgccctgcggagtgggccacggaggtactccaggacccgtttgcccca
ttctttatccttagcggagtcacgcgcctgattgaggcactactgcaggcccgcgatgct
ccgctggcacgcttctacgtgactctgctggggcgcctccttccgcgttgcccctgcccg
acacaactccaagtattcctgcgcgttgtgcaccgcctggccaccgtgctcaccaccacc
cacctctccgctgcagactacgcggctccagacagcctctacggagcggccttggcaagg
tggcaacgtctgaagaccgccctagagcacgtggacgcagagctctccgacgcggacggc
gcggacggctcaaggcatgttgactggccacggcagaacaccgcgggtcttgcgtgggac
gctcggaagcatcttcaatgtttctgcgcgcccagaagagtagagaacgttcgcaccgcc
gcctctgctcagatcacgccccaatccccagctgtcgccctgggcaccgttgtggtgctc
tgctacgtccccgccggctcgcagagtgaaggggaggggctgctgtggctccggcgcact
cgggccagcgccacgtgtccctcaggagagcagcgggtgcaggaccagcagctgctcagc
ctaacggcgcgctgccctgtggggggagcgctgaggtcatgtgcagctgagatggcagac
gtgatgaaccgaaaccgagcacaactgatgcggggcgacgcaagcgcagtcggggagacg
ggtcggtgccttgacagccaaggctcacgtgaactcgccgcaagcacaagctgcgcgtgc
cagcaagcaagcgacggtaccgcggcgccgatcgaaacggatgctcagcgacagcgacgg
cgcaaggaggcgtggtggtgtgaacggttcgagcttgacgatcgtattggccgggtcgca
gcgtccatgcaagatgccctcggcgcggcgcatatgctgctgctcggcgaccccagttcc
tctctcggtggccagctgcaaacactggcagcgcgttttgcttgcgagtgtgtgcgcctc
cgcggtgccagtcactgccctcctgtggaggccttgcagcacgtcactctgcaagttctt
gcggcggctccgtacctgtggaaagataagacaccgcctcgtgggcagaccacgtgctgg
tacggcccccgcaacgcacgcagttgcgcgtgctgtatgcagacagtgaagcgcgcgcaa
aggatgctgctcgaggcggtcacggctctggggcagttggtcactgccgccacagcagca
gcgatggagtcctctttgtcgtgtgcactcgctagcgagcccgcgaacgtggaggaatgc
tggctggcgctgttggcggataggtcggtgcagggtgttgtggaagaaatggtgccggct
gtgttgaacgcgtactaccgcgagctcaccccagacgccgccgcgaacgctccgcgtgat
gatgaggagcgcggccaccaccatgcggacttgctccttgtctcacgcgagcacgtgtac
ctggtgctggacggagagctgcacgcgctgccttgggaagctctgggtgtgtgccaagag
cgtagcgtctctcgcgtgccatcgctcgaatacctgaagtactgcagcaccgacgcgtcg
gccgtatccctgcagcgcttgcttgtctaccgcgatgacgcggcgctgcagcacggcccc
tccagccttacggatctcatcacgcagcacccacattgggaagtggtctacggagaaacg
ctgcaggcagcaactgcggcggcacgagacggcagcagcgccgtcacatcgccgctaatg
cgccgcctcctctcccagtgtgaggcggcgagcgatcgcatagacacgtatgtgtacgct
ggtcacaagggcggggagcacgtggcccctcgcggagcactgtacgactggattcccgct
gcagccggcacacccccgacgctggtgctgctgatgggctgcagctctgctcgcatgcag
gccagcgcgctctacgactgctttggcctgcccttcgcatacctcagtgcaggcgtgtcg
tgcgttctgggttgcctgtgggacgtcacggacgccgacattgaccgcctcacgggtcgc
tttctccaagtggccagtcagacgacggcggacggcgaaggcataaccgtcggggagtgc
ctggcggtggcgcgccgggcctgcaagctgcagtacctgacaggcatggccaccgtcttc
tatggcgtgaactgttacgtgacggctgcgagggaggacaacagcaagggtgctgcgtga

DBGET integrated database retrieval system