KEGG   Leishmania infantum: LINJ_21_0890Help
Entry
LINJ_21_0890      CDS       T01112                                 

Definition
(RefSeq) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lif  Leishmania infantum
Pathway
lif00450  Selenocompound metabolism
lif00970  Aminoacyl-tRNA biosynthesis
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LINJ_21_0890
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LINJ_21_0890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lif01007]
    LINJ_21_0890
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lif03016]
    LINJ_21_0890
Enzymes [BR:lif01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LINJ_21_0890
Amino acid related enzymes [BR:lif01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LINJ_21_0890
Transfer RNA biogenesis [BR:lif03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LINJ_21_0890
 Prokaryotic type
   Other AARSs
    LINJ_21_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 5068812
NCBI-ProteinID: XP_001465394
UniProt: A4HZ82
Position
21:263449..265692
Genome map
AA seq 747 aa AA seqDB search
MLKFFTEKANHQALKAVLCAMFVQKPLEVTLGSTYSTPYLQLPKSRALLYSCNEAARLLW
NTHAAPSPADNSLEGEAEWLEWESTVLTPALTPLYTQRRITGEAEVALKKLDSTIEEHQG
TVAVKGAPSSTSFLVDSVLFASLLPALCEGGLLPAAQAARVPHLVKWFQVFQAEHAELIA
SAFDVLSVQECSDFLRVPQTYEVSPKKQKVFFATTPIYYVNASPHIGHVYSTLIVDVLGR
YHRVKGEEVFVMTGTDEHGQKVAEAAAKQGVSPMDFTTSVSSEFKQCFKEMNYDMNYFIR
TTNPTHEKLVQDIWKKLEAKGDIYLGKYEGWYSVSDESFLTAQNVADGVDKDGKPCKVSL
ESGHVVTWVEEENYMFRLSAFRERLLKYFHDHPNCIVPEFRRREVIKTVEKGLFDLSISR
KRESVMNWSIPVPGDERHCIYVWLDALFNYYTGALTRVAADGTETLDEDHHTLNRWPADV
HVVGKDILKFHAIYWPAFLMSAELPLPERLVSHGWWTKDRRKISKSLGNAFDPVEKAKEF
GIDALKYFLMRESNFQDDGDYSDKNMVARLNGELADTLGNLVSRCVAPKINVNGMWPEPA
EYSESDKTLIASLNNLAGTVDHYYCLPDIQHALIAIFDVLRSLNAYVTENAPWKLVKTDT
ARLGTVLYVTMEGLRICTMFLQPVMPQKAKEIMDALGVPEAARVDMENYLFGIVKPRTKI
AGLAEGQVIFQKVTLPTEEGERIPEGQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagttttttacagagaaggcgaatcatcaggccctcaaggccgtgctttgcgcc
atgtttgtgcagaagcccctcgaggtgacgctgggcagcacctacagcacgccgtatctt
cagctgcccaagtccagggcgcttctgtacagctgcaatgaggcggcacgtcttctctgg
aacacgcacgctgcgccgtcgcccgccgacaactcgctcgaaggagaggcggaatggctc
gagtgggagtcgacggtgctgacgccagccttgacccccctctacacgcagcgacgcatc
acgggcgaggctgaggttgccctgaagaagctcgactccaccatcgaggagcaccagggc
accgtggcggtgaagggggcgccgtcgtccacgtctttcttagtcgacagtgtcctcttc
gcgtccctcctgccggctctgtgcgagggtgggctgctccccgccgcgcaggcggcgagg
gtgccgcatttggtgaagtggttccaggttttccaggcggagcacgcggagctgattgcc
tctgcgtttgacgtgctgtcggtgcaagagtgcagcgacttcttgcgggtgccgcagacg
tacgaggtgagccccaagaagcagaaagtcttcttcgccacgacgccgatctactacgtg
aacgcgtcgccacacatcggccacgtctacagcacgctcatcgtcgacgttctcggccgc
tatcaccgagtgaagggagaggaggtgtttgtgatgacgggcacggacgagcacggccag
aaggtggccgaggcagcggcgaagcagggggtatcgccgatggacttcacaacgagcgtg
tcgagcgagtttaagcagtgtttcaaggagatgaattatgacatgaactacttcatccgc
acgacgaacccgacgcatgagaagctggtgcaggacatctggaagaagctggaggcgaag
ggcgacatctacctcggcaagtacgagggctggtactcggtgagcgacgagtcattcctg
acggcgcagaacgtggcggacggtgtagacaaggatggaaagccgtgcaaggttagcctg
gagagcggccacgtcgtgacgtgggtggaggaggagaactacatgttccgtcttagcgcg
ttccgcgagcgtctcctcaagtacttccatgaccatcccaactgcatcgtcccggagttc
cgccgccgcgaggtgatcaagacagtcgagaagggtctcttcgacttgtccatctcccgc
aagcgcgagtccgtcatgaactggtccatcccggtccccggtgatgagcgccactgcatc
tacgtgtggctggatgccctcttcaactactacaccggcgccctgacccgtgtcgcagcc
gacggcaccgagacactggacgaggaccaccacacactgaaccggtggccggccgacgtg
cacgtggtcggcaaggacatcctcaagtttcatgccatttactggccagccttcctgatg
tccgcggaactgccgctgccggagcggctggtgtcgcatggctggtggacaaaagatcgc
aggaagatcagcaagtcgctcggcaacgccttcgacccggtggaaaaggcgaaagagttc
ggcatcgacgcgctcaaatacttcctgatgcgcgagtcgaacttccaggatgatggcgat
tacagtgacaagaacatggtggcccgcctgaatggcgaactcgccgacacgctcggcaac
ttggtgtcgcgctgtgtggcgccgaagatcaatgtgaacggtatgtggccggaacccgca
gagtacagcgagagcgacaagacgctgatcgcctcgctcaacaacctggctggcacggtg
gaccactattactgcctgcctgacattcagcacgcgttgattgccatctttgacgtgctc
cgcagcctcaacgcctatgtgactgagaacgcaccgtggaagctggtgaaaacggacacg
gcgcgtctcggcacagtgctgtatgtaacgatggagggtctgcgcatctgcaccatgttc
ctgcagccggtgatgccgcagaaggcgaaggagattatggacgcgctcggggtgccggag
gcggcgcgcgtggacatggaaaactacctattcggcattgtaaagccgagaacgaagatt
gctggcttggcggagggccaggtcatcttccagaaggtgacactccccactgaggagggg
gagcgcattcccgaaggacagtaa

DBGET integrated database retrieval system