KEGG   Leishmania infantum: LINJ_23_0580Help
Entry
LINJ_23_0580      CDS       T01112                                 

Definition
(RefSeq) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lif  Leishmania infantum
Pathway
lif00010  Glycolysis / Gluconeogenesis
lif00620  Pyruvate metabolism
lif00640  Propanoate metabolism
lif01100  Metabolic pathways
lif01110  Biosynthesis of secondary metabolites
lif01130  Biosynthesis of antibiotics
lif01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_23_0580
   00620 Pyruvate metabolism
    LINJ_23_0580
   00640 Propanoate metabolism
    LINJ_23_0580
Enzymes [BR:lif01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LINJ_23_0580
Lipid biosynthesis proteins [BR:lif01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LINJ_23_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 5069157
NCBI-ProteinID: XP_001465734
UniProt: A4I093
Position
23:199525..201642
Genome map
AA seq 705 aa AA seqDB search
MSDNPHSLHPLSSDSTSQALHSSTKPPATPHEGEFHSVRDSNVVEPTEANGKKSHVGPHL
GSRMRIYEYSIEHNDAFWAEIARRDFYWKTTWPDDQHVKSYNFDKSKGPIFVKWFEGAVT
NVCYNALDRHLPAHKDRVCFYFEGNDPSVTEAVTYGSMYTRVVELANVLKYQYGIAKGDR
VGLYLPMIPFAAVAMLACARIGAVITVIFGGFSAQALSSRLKDAQTKLLITADASARGTK
PIPLKDVADEALKECEEEGMSIACLVAENMNRQSCKMKEGRDTWYGDALARLTPEQHEEC
PVEWMDAEDVLFLLYTSGSTGKPKAIVHTTAGYMVYASTTFMYSFDYHMDDVYFCTADIG
WITGHSYVVYGPMIHCATSVLFEGVPNYPDYSRWWQLVEKYKVSILYTAPTAIRSLMQAG
DDYVKVGNRSTLRVLGSVGEPINVEAWKWLRDVGGEGHCDVSDTWWQTETGGHMITPMPG
CTPMKPGSATLPFFGVQPVILDPMKLHEKQGPAEGLLAIRAPWPGMARTIYGDHARFEKT
YFGVDGYYMTGDGARRDSDGYYWITGRVDDVLNVSGHRIGTSEIEDAVNTHPAVVESAVV
GFPHNIKGEGIYVFLTFRQGTEVTPELLAAVKATVRKVIGPLATPDVMQVARVGLPKTRS
GKIVRRILRKVSAGQYTELGDTSTLANPDVVEDLIAEHQRLCSQN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatcctcactcgctgcatccgctgtcgtcggactcgacaagtcaagcattg
cactcctcgacgaagccccctgccaccccgcacgaaggcgagtttcacagtgtgcgggac
tcgaacgttgtggagccgacagaggcgaacgggaaaaagtcgcacgtcggcccccacctc
ggctctcgcatgcgcatctacgagtactccatcgagcacaatgacgccttctgggccgaa
attgcacggcgcgacttctactggaagacgacctggccggatgaccagcacgtcaagtcg
tacaacttcgacaaatccaagggccccatctttgtgaagtggttcgagggcgccgtgacg
aacgtctgctacaacgcgttggaccgccacctgccggcgcacaaggatcgcgtgtgcttt
tactttgaaggcaacgacccgagtgtgacggaagcagtcacgtacggcagcatgtacacg
agggtggtggagctggcgaacgtgctgaagtaccagtacggtattgcaaagggcgaccgc
gttggcctgtatctacccatgatcccgttcgctgcggtggccatgctcgcctgcgcccgc
atcggtgctgtcatcaccgtgatcttcggcggcttctcggctcaggcgctcagctcacgc
ctgaaggacgcccagacaaagctgcttatcacggccgacgcgtcggcgcggggcacaaag
ccgattcctctcaaggacgtggcagacgaggcgctgaaggagtgcgaggaggaaggcatg
tccatcgcgtgcctcgtcgctgaaaacatgaaccgtcaatcctgcaagatgaaggaaggc
cgagatacctggtacggcgatgccttagcccgactgacgccggagcagcacgaggagtgc
ccggtggagtggatggacgcggaggatgtgctgttcctgctctacacctccggcagcaca
gggaaacccaaagccatcgtgcacacgacggcgggctacatggtgtacgcctccaccacc
ttcatgtacagcttcgactaccacatggacgacgtgtacttctgcacggctgatattggc
tggatcacaggccacagctacgtcgtgtatggtccgatgatccactgcgccacgtcggtg
ctgttcgagggtgtgccgaactaccccgactactcgcgctggtggcagctcgtcgagaag
tacaaggtgtccatcctctacaccgcgcccaccgcgatccgctccctcatgcaggccggc
gacgactacgtcaaggtgggcaaccgcagcaccctgcgtgtgctgggctctgtcggcgag
ccgatcaacgtggaggcgtggaagtggctgcgcgatgtcggcggcgagggccactgcgat
gtgtcggacacgtggtggcagaccgagacgggcggccacatgattacaccgatgccgggc
tgcacccccatgaaacccggtagtgcaacgctgccgttcttcggtgtccagccggttatt
ctcgaccccatgaagctgcatgagaagcagggccccgcggagggcctgctcgccattcgc
gcgccgtggcctggtatggcccgcaccatctacggtgaccacgcacgctttgagaaaacc
tactttggcgtggacgggtactacatgacaggcgacggtgctcgccgcgactcggacggc
tattactggatcacgggccgcgtcgatgacgtgctgaacgtgagcgggcaccgcatcggc
accagcgagatcgaagacgccgtcaacacccacccggccgtggtggagagcgccgtcgtc
ggcttccctcacaacatcaagggtgagggcatctacgtcttccttacgttccgccagggg
acggaggtgacgcccgagctgctggcggcggtgaaggcgactgtgcgcaaggtgattggc
ccgctggccacgccggacgtgatgcaggtggctcgcgtagggctgcccaaaacgcgctcc
ggcaagattgtgcgccgcatcctgcgcaaggtatcggctgggcagtacacggagctgggc
gacacctcgacgctggcgaaccccgacgttgttgaggacctcatcgccgagcaccagagg
ctgtgctctcagaactag

DBGET integrated database retrieval system