KEGG   Leishmania infantum: LINJ_27_2290Help
Entry
LINJ_27_2290      CDS       T01112                                 

Definition
(RefSeq) sucrose hydrolase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lif  Leishmania infantum
Pathway
lif00052  Galactose metabolism
lif00500  Starch and sucrose metabolism
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LINJ_27_2290
   00500 Starch and sucrose metabolism
    LINJ_27_2290
Enzymes [BR:lif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LINJ_27_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5070182
NCBI-ProteinID: XP_001466469
UniProt: A4I336
Position
27:995294..996763
Genome map
AA seq 489 aa AA seqDB search
MSHEQRIEEANNAVLAIRKSVDKEFYPHYHIAPYARSMSAPCGMIYFKGLYHVFYQHQPF
AEESGPMHWGHSTSENMIHWRHHPIALAPGEDWDRDGCFCGSSVAYDDRLYVFYTGHHWL
TDIADDSQIYQVQCLAISENGFNFEKRGIVVKPPAGFSHFRDPYVWFQDGRWWMVCGGRD
SKDQGQLLLYSTDDLEDWDDSTFMILSKSEDRNVYMWEHPCFFPLQRHQMLMFSPQGMQP
EDYMFRNRYQTGLLMGLWRPNATFSVTSAFKKLDLGHDFYCAQTFLTRDGRRVFIGWLDM
WDTNMPTKQHHWTGMLSLPRVLLVDEATGRIRTPPIKELESIRGNHQYLPRQTVRDNSQV
RLLFDCTSYEVRVLFDMEKSTAEKYGLWLGRGLEIYVDEQSKRLVVNRHYPNYGISGYRS
YALPAQALLLVHAYFDMSSVEVFVNEGEAVLSTRIYPARKDRTLSLFAANGTAHITRGDI
WALNQSVMQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgaacagcggattgaagaggcgaacaacgccgtgctggcgatccgcaaaagt
gtcgacaaggagttttacccgcactatcacattgccccttatgcccgctccatgagtgcg
ccatgtggcatgatctactttaagggtctctatcacgtcttttatcagcatcaaccattt
gccgaagagtcgggcccgatgcactggggtcattccacgagcgagaatatgattcactgg
cggcaccaccccatcgcgctcgcacccggagaggactgggaccgcgatggctgcttctgt
ggcagctcggtcgcgtacgatgatcgactctatgtattttacactggccaccattggctc
actgatattgctgatgatagccaaatatatcaggttcagtgcctggctatcagcgaaaac
gggtttaactttgagaagcgaggcatcgtagtaaagccgccagccggcttctcccatttc
cgggacccgtacgtgtggtttcaggatgggcggtggtggatggtgtgcggcggtcgcgac
tccaaggaccagggccaacttctcctgtacagcaccgatgacctggaggattgggatgac
agcacattcatgattctatccaagtcggaggaccgtaatgtgtacatgtgggagcaccct
tgctttttccctctgcagcgtcaccagatgctcatgttctcgccgcaaggtatgcaacct
gaagattacatgttccgcaaccggtaccaaacagggcttctgatgggtctgtggagaccg
aacgcgacctttagcgtcacctccgcgttcaagaagctggacctcggccacgacttttac
tgcgctcagaccttcctaacgcgcgacggccggcgtgtgttcattggctggctggacatg
tgggacacgaacatgcccacaaagcagcaccattggaccggcatgctctctctgcctcgc
gtcctccttgtcgacgaagctactggcagaattcgtacaccccccatcaaggagctggag
agtatacgtggcaaccaccaatacctaccgcggcagactgtgcgcgacaattcgcaggtt
cggttactattcgactgcacgtcttacgaggtacgcgtgctgtttgacatggaaaaaagc
acggcggaaaagtacggcctgtggctcggtagaggcctagagatctacgtcgatgagcaa
agcaagcgtctcgtggtaaaccgccactaccccaactacggcattagcggataccgcagc
tacgcgctgccggcgcaggctcttctgctagtgcacgcgtactttgacatgtctagcgta
gaagtctttgtgaacgaaggcgaggccgtgctgagtacccgcatttatccggcgcgcaag
gatcggacgctttctctctttgcagccaatggtaccgcccacatcacgcgaggtgatatt
tgggcgctgaaccagtcagttatgcagtag

DBGET integrated database retrieval system