KEGG   Leishmania infantum: LINJ_28_2950Help
Entry
LINJ_28_2950      CDS       T01112                                 

Definition
(RefSeq) putative heat-shock protein hsp70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lif  Leishmania infantum
Pathway
lif03040  Spliceosome
lif04141  Protein processing in endoplasmic reticulum
lif04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lif00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LINJ_28_2950
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LINJ_28_2950
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LINJ_28_2950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lif01009]
    LINJ_28_2950
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lif03041]
    LINJ_28_2950
   03009 Ribosome biogenesis [BR:lif03009]
    LINJ_28_2950
   03110 Chaperones and folding catalysts [BR:lif03110]
    LINJ_28_2950
   04131 Membrane trafficking [BR:lif04131]
    LINJ_28_2950
   03051 Proteasome [BR:lif03051]
    LINJ_28_2950
   03029 Mitochondrial biogenesis [BR:lif03029]
    LINJ_28_2950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lif04147]
    LINJ_28_2950
Protein phosphatases and associated proteins [BR:lif01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LINJ_28_2950
Spliceosome [BR:lif03041]
 Complex B
  Other components
   Prp19 complex
    LINJ_28_2950
 Complex C
   Prp19-CDC5 complex
    LINJ_28_2950
Ribosome biogenesis [BR:lif03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    LINJ_28_2950
Chaperones and folding catalysts [BR:lif03110]
 Heat shock proteins
  HSP70 / DNAK
   LINJ_28_2950
Membrane trafficking [BR:lif04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    LINJ_28_2950
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LINJ_28_2950
Proteasome [BR:lif03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LINJ_28_2950
Mitochondrial biogenesis [BR:lif03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    LINJ_28_2950
Exosome [BR:lif04147]
 Exosomal proteins
  Proteins found in most exosomes
   LINJ_28_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl Asp_decarbox FGGY_C
Motif
Other DBs
NCBI-GeneID: 10966670
NCBI-ProteinID: XP_003392679
UniProt: E9AHH0
Position
28:complement(<1063717..1065579)
Genome map
AA seq 621 aa AA seqDB search
MPWYLFSTTSSPRCALPLPPFYPPNHTQDPKHALALKLSEENTYAHRHTSLSLCALLRNP
ITTLLPPPPIPHAHTHTTTAAEMTFDGAIGIDLGTTYSCVGVWQNERVDIIANDQGNRTT
PSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKG
DDKPMIAVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQA
TKDAGTIAGLEVLRIINEPTAAAIAYGLDKGDDGKERNVLIFDLGGGTFDVTLLTIDGGI
FEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRALRRLRTACERAKRTLS
SATQATIEIDALFENVDFQATITRARFEELCGDLFRSTIQPVERVLQDAKMDKRSVHDVV
LVGGSTRIPKVQSLVSDFFGGKELNKSINPDEAVAYGAAVQAFILTGGKSKQTEGLLLLD
VTPLTLGIETAGGVMTALIKRNTTIPTKKSQIFSTYADNQPGVHIQVFEGERAMTKDCHL
LGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAEEKGTGKRNQITITNDKGRLSKDEI
ERMVNDAMKYEADDRAQRDRV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgccatggtacctcttctccaccacgtcctctcctcgctgcgccctccctctccctccc
ttctatccaccaaaccacacgcaggatcctaaacacgcactcgcactcaagctgtccgaa
gagaacacatacgcgcacaggcatacgtctctctcgctctgcgctctattacgtaaccct
ataaccaccctcctccccccaccccccatcccacacgcacatacacacacgaccactgcc
gcagagatgacattcgacggcgccatcggcatcgacctgggcacgacgtactcgtgcgtg
ggcgtgtggcagaacgaacgcgtggatatcatcgcgaacgaccagggcaaccgcacgaca
ccgtcgtacgttgcgttcacggactcggagcgcctgatcggcgatgccgcgaagaaccag
gtggcaatgaacccgcacaacacggtgttcgacgcgaagcgcctgattggccgcaagttc
aacgactcggttgtgcagtcggacatgaagcactggccgttcaaggtgacgacgaagggc
gacgacaagcccatgattgcggtgcagtaccgcggcgaggagaagaccttcacgccggag
gagatcagctcgatggtgctgctgaagatgaaggagacagcggaggcgtacctgggcaag
caggtgaagaaggccgtggtgacggtgccggcgtacttcaacgactcgcagcgccaggca
acgaaggacgccggcacgattgctggcctggaggtgctgcgcatcatcaacgagccgacg
gcggcggccatcgcgtacggcctggacaagggcgacgacggcaaggagcgcaacgtgctg
atcttcgaccttggcggcggcacgttcgatgtgacgctgttgacgatcgacggcggcatc
ttcgaggtgaaggcgacgaacggcgacacgcaccttggcggcgaggacttcgacaaccgc
ctcgtcacgttcttcaccgaggagttcaagcgcaagaacaagggtaagaacctggcgtcg
agccaccgcgcgctgcgccgtctgcgcacggcgtgcgagcgcgcgaagcgcacgctgtcg
tccgcgacgcaggcgacgatcgagatcgacgcgttgttcgagaacgttgactttcaggcc
accatcacgcgcgcgcgcttcgaggagctgtgcggcgacctgttccgcagcacgatccag
ccggtggagcgcgtgctgcaggacgcgaagatggacaagcgctccgtgcacgacgtggtg
ctggtgggcgggtcaacgcgcatcccgaaggtgcagtccctcgtgtcggacttcttcggc
ggcaaggagctgaacaagagcatcaaccccgacgaggctgtcgcgtacggcgcggcggtg
caggccttcatcctgacgggcggcaagagcaagcagacggagggcctgctgctgctggac
gtgacgccgctgacgctgggcatcgagacggccggcggcgtgatgacggcgctgatcaag
cgcaacacgacgattccgaccaagaagagccagatcttctcgacgtacgcggacaaccag
cccggcgtgcacatccaggtcttcgagggcgagcgcgcgatgacgaaggactgccacctg
ctgggcacgttcgacctgtccggcatcccgccggcgccgcgcggtgtgccgcagatcgag
gtgacgttcgacctggacgcaaacggcatcctgaacgtgtccgcggaggagaagggcacc
ggcaagcgcaaccagatcaccatcaccaacgacaagggccggctgagcaaggacgagatc
gagcgcatggtgaacgacgcgatgaagtacgaggcggacgacagggcgcagcgcgaccgc
gtg

DBGET integrated database retrieval system