KEGG   Leishmania infantum: LINJ_30_1920Help
Entry
LINJ_30_1920      CDS       T01112                                 

Definition
(RefSeq) succinyl-coa:3-ketoacid-coenzyme a transferase-like protein
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
lif  Leishmania infantum
Pathway
lif00280  Valine, leucine and isoleucine degradation
lif00650  Butanoate metabolism
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LINJ_30_1920
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LINJ_30_1920
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LINJ_30_1920
Enzymes [BR:lif01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     LINJ_30_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 5071082
NCBI-ProteinID: XP_001467038
UniProt: A4I5L9
Position
30:685495..686994
Genome map
AA seq 499 aa AA seqDB search
MLRRTRRALRPMVMSAAESVQDIHDGATIAAGGFGFCGFPFELFDAVNATKATNLTVIGA
TMGGVDSGFGPLARDGQLKKAITTYVGENPLFTKHLFHGEFEIEFCPMGTLVDRLRAAGA
GLPAFYTPTGYGTAVAEGRLPVRFAPGKAVRVAEYSQPRETRQFNGRWCTLEMALPADFA
FVRAWKADKRGNLVFRGTTQNFNLASAKAAKVCIAEVEEIVECGELDPKTVHLPGVYVHR
LVCPPNIRRAAEFVVERKPGFSTGTGKNAHAGRNLIARRAALEIKDGMTLNLGIGIPNMV
ASYIPPEMDVVLQGENGLLGIGPYPLPEEVDPDITNAGKQTVTMSKSGASLFDSAESFSM
IRGGHLDLTMLGALEVSGTGDIASWWVPGKVLKGMGGAMDLVVCGCKTIVLMEHTDKEGK
SRVVENCRAPVTGRECLDMIITDLAVFVVQKTAGGVRSLVLMEIAEGLTVEEVKAKTEAC
FAVAADLKTMPLAPVPSQT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgtacacggagggccctccggccaatggtgatgagtgcggccgagtctgtt
caggacattcacgatggtgccaccatcgcggccggtggctttggtttttgcggcttcccg
ttcgagcttttcgacgccgtcaacgccaccaaggcgacgaacctcacggtgattggggcg
acaatgggcggcgtggacagcggctttggtccgcttgcgcgagacgggcagctaaagaag
gccatcaccacgtacgttggcgagaacccgcttttcacgaagcacctctttcacggcgag
tttgaaatcgagttttgccccatgggcacgctggtggaccgtctgcgcgctgcgggtgcg
gggctgcccgccttctacacccccaccggctacggcaccgcagtagccgagggccgcctc
cccgtgcgctttgcgccgggcaaggcggtgagggtggccgagtacagccagccacgcgag
acgcggcagttcaacgggcggtggtgcacgctggagatggcgctgccggcggactttgcg
tttgtgcgcgcgtggaaggcggacaagcgcggcaacctcgtgttccgcgggacgacgcag
aacttcaaccttgcgtccgcgaaggctgcgaaggtgtgcatcgcggaggtggaggagatt
gtggagtgcggggagctggacccgaagacggtgcacctgcccggcgtgtatgtgcaccgc
ctggtgtgcccaccgaacatcaggagagccgccgagttcgtggtggagcgcaagcctggg
ttctcgacggggaccgggaagaacgcacatgcaggccgcaatctcatagctcgccgcgca
gcccttgagatcaaggatggcatgacactgaaccttggcatcggcatccccaacatggtg
gcgagctacattccgcctgaaatggacgtggtgctgcagggagaaaacggcttactcggc
attggcccctacccgctgccggaggaggtggaccccgacatcactaacgccggcaagcag
accgtcaccatgagcaagtcaggtgcttcgctgttcgacagcgccgagtccttcagcatg
attcgcggtggtcatttggacttgacgatgcttggcgcgctggaggtctctggcaccggc
gacattgccagctggtgggtgcctggcaaggtgctgaagggcatgggtggggccatggac
ctggtggtgtgcggttgcaagacgatcgtgctgatggagcacacggacaaggagggtaag
tcgcgcgtcgttgagaactgcagggcccccgtcacgggtcgtgagtgtcttgacatgatt
atcacggatctggccgtctttgtcgtgcagaagacggcggggggtgtgaggtcgctggtc
ttgatggagatcgccgagggtttgacggtggaggaggtgaaggccaagactgaggcatgc
ttcgccgtggctgcggacctcaagacgatgccgttggcgcctgttccaagtcagacgtag

DBGET integrated database retrieval system