KEGG   Leishmania infantum: LINJ_32_0970Help
Entry
LINJ_32_0970      CDS       T01112                                 

Definition
(RefSeq) putative vacuolar proton-ATPase-like protein
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
lif  Leishmania infantum
Pathway
lif00190  Oxidative phosphorylation
lif01100  Metabolic pathways
lif04145  Phagosome
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LINJ_32_0970
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    LINJ_32_0970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lif04147]
    LINJ_32_0970
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LINJ_32_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 5071836
NCBI-ProteinID: XP_001467777
UniProt: A4I7Q8
Position
32:345524..348205
Genome map
AA seq 893 aa AA seqDB search
MPWRQEHCSGLWRSEDMIRVNIILQREVLHDTMYEVGMLGRVQFLDMNEGVTAFARPFTE
ELRRCEELQRKLHFIEESMCKDADLLERYPGDVNMSATVEEMRSSLLRGQMHMIDDRIES
TVNELTAMLTSLEGFQHEMNQNQEMSLLYYKYRLLVDTPSDMAASNSTSPHHGAAVSSDA
FSRLASLFGFIESKLSEELYRLCYRITRGNAIVEISNEPAMFVDVQTGERNVAKTSFVVL
CASPTMIVRLKKLMIGLGADVYTLDEVQSRGIELTTSTTAHHVEDTIEGVERRKRDVLTQ
WYEEHRLYKTYLKVEKVVLTAMNMCAMSGSTCTASAWVPLRHEQSLRRALQDAVASANGS
VESIVTLHAEQKHPPTFFETNRFTESFQGIVDSYGMARYKEVNPGVFTIITFPYLFGIMY
GDIGHGFLLLFIALFFIGKEKAWRTAQLNEIVAMVFGGRYLLLLMSLFAIYMGVLYNDFF
GFSLNLFSSGYTWAPISEQKGTTYPTTPNGLPSVKPPHVYAMGLDAAWTETDNKLEFYNS
VKMKHAVIVGVAQMFAGLLLSLSNSIYEKNWYKIAFLFVPEFVFLLCTFGYMSILIMVKW
CRTWENTNKAPSILEIMTNFFLQPGSVPNPLFSGQAGLQVFLLLAAFAMVPFMLLGMPYI
EMRDYKRWQQRRQVGGSRRHHGRALRVSVVAIETSDYTDVFLNEPSASLQHRQANYSGDE
SAHRNLMSDDDETANIFGDDSMHPFGVSTANSEEGATATVIERENEKFEHFDVSELIIHY
VIHTIEYVLSSVSNTASYLRLWALSLAHAQLSEVFFSFTVAKTLDIDNSSGFVIAIGVLL
WLGATLGVLVGMEALSAFLHALRLHWVEFQNKFYAGDGQTFDPLDLTTLNTAN
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggcgtcaggaacattgcagcggcttgtggcggtcggaggacatgatccgcgtc
aacattatccttcagcgagaggtcctgcacgacaccatgtatgaggttggtatgctgggc
cgcgtgcagttcctcgacatgaacgagggggttactgcgtttgccaggccgttcacagaa
gagctgcgccgctgcgaggagctgcagcgcaagcttcacttcattgaggagtcgatgtgc
aaggacgcggacttgctcgagagataccccggggacgtgaacatgagcgccaccgtggaa
gagatgcggtcatcgttgctgcggggacaaatgcacatgatcgacgaccgcatcgagtcg
accgtgaacgagttgaccgcaatgctcacatcgctcgaagggttccagcatgagatgaac
cagaaccaggagatgtcactgctctactacaagtacaggctcttggtggatacaccgtcc
gacatggcagcgagcaacagcacctccccccaccacggcgctgccgtcagctcggatgcg
ttctcccggctagccagcctcttcggcttcattgaatcaaaactcagcgaggagctctac
cgcctctgctaccgcatcacccgcggcaacgccatcgtcgagatcagtaacgagccggcc
atgtttgtcgacgtccagactggcgagcgcaatgtggccaagacgtcatttgtggtgctg
tgcgcctcgccgacgatgatcgtccgcttgaagaagctcatgattgggctcggcgccgac
gtttacaccctggacgaggtgcagagtcgcggtatcgagctcaccacctccaccaccgcc
caccacgtcgaggacaccatcgagggggtcgagcggcgcaagcgcgatgtgctgacgcag
tggtacgaagagcaccggctgtacaagacctacctaaaggtagagaaggtggtgctgacg
gcgatgaacatgtgtgccatgtccggctccacctgcacggcctccgcgtgggtaccactg
cgccacgagcagtcccttcgccgtgcgctgcaagacgccgtcgcctcggcaaacggcagc
gtcgagtccatagtgacgctccacgccgagcagaaacacccgccgacgttttttgagact
aaccgctttaccgagtcgttccagggaattgtcgacagctacggtatggcacgctacaag
gaggtcaacccgggcgtgttcaccatcatcacgttcccgtacctgttcggcatcatgtac
ggcgacattggccacggctttctgctgctcttcatcgccctctttttcatcggcaaggaa
aaagcgtggcggacggcgcagctcaacgaaatagttgccatggtgttcggcggccgctac
ttattgctgctcatgtccctctttgccatctacatgggagtcctgtataacgacttcttt
ggcttttctctgaacctcttctccagcggctacacgtgggccccgatctcggagcagaag
ggcaccacctacccgacgacgccgaacgggcttccaagtgtgaagccgccgcacgtttat
gcgatgggtctggatgcggcatggactgagacagacaacaagctggagttctacaactct
gtgaagatgaagcacgctgtcattgtcggcgtggcgcagatgttcgctggcctcttgctc
tcgctcagcaatagcatctacgagaagaactggtacaagatcgccttcttgtttgtgccc
gagttcgttttcctactttgtacctttggatacatgtcgatcctcatcatggtgaagtgg
tgccgcacgtgggagaacacgaacaaggcgccgagcatcctggagatcatgacgaacttt
tttctgcagcctggctcggtgccgaacccgctcttcagtggacaggccgggctgcaggtg
tttctgctcctcgcggcttttgcgatggttccgttcatgctgctgggaatgccatacatc
gagatgcgggactacaagcggtggcagcagcgccggcaagttgggggcagccgccgccac
cacggcagagcgctgcgggtcagcgtggtcgcaatcgaaacctcagactacacggacgtc
ttcttgaatgagccgtcggcgtccctgcagcaccggcaggccaactacagcggtgacgag
agcgcgcatcgcaatttgatgagtgacgacgacgaaacggcgaacatcttcggtgacgac
agcatgcatccctttggcgtgtctacagcgaacagtgaggaaggtgccacagccacggtg
atcgagcgcgaaaacgagaaattcgagcactttgatgtctcggagttgatcatccactat
gtgattcacaccatcgagtatgtgctgagcagtgtgtcaaacaccgcctcgtacctgcgt
ctgtgggcgttgtcgctcgcccacgcgcagctttccgaggtcttcttcagcttcacggtg
gccaaaacgctcgacatcgacaacagctctggcttcgtgattgccattggggtgctgctg
tggcttggcgcgacactcggtgtgctggtgggcatggaggcgctgtcggcgtttttgcat
gcgctgcgtctgcactgggtggagttccagaacaagttctacgctggcgacgggcagacg
ttcgatccgctggacctgacaaccctcaacacggcaaactag

DBGET integrated database retrieval system