KEGG   Leishmania infantum: LINJ_32_2470
Entry
LINJ_32_2470      CDS       T01112                                 

Definition
(RefSeq) putative C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lif  Leishmania infantum
Pathway
lif00100  Steroid biosynthesis
lif01100  Metabolic pathways
lif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LINJ_32_2470
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LINJ_32_2470
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 5071987
NCBI-ProteinID: XP_001467924
UniProt: A4I855
Position
32:complement(914575..915888)
AA seq 437 aa
MAKGRGAASKAEANPLQPRTKTYEWGGPVGALFMVAFLPTLVVALNSLCAAEQCSLMLAM
RMPALMKEVVQGAWPMLRTAIGIELAWIAAHAVFSILPIGKLVYGAELRSGERLAYRMNA
IHAFVVAHLVLFGLHFTSILNMAVVADLYHPLMIGAILISFAMSVVLYAASYRSRNVLTA
LGGNSGSVLYDFWVGRELNPRTGPLDWKLMCELRPGLIGWSILNWAFVCKSVELGTVTPS
IVLTALFESFYVLDGLLLEAGNLSMMDIVTDGFGFMLCFGDLAWVPFTYTLQTKYLVHHP
AHLSLVHLCLCVSLSAAGYLIFRNANTEKDRFRKNPQDPRVQHLRIMKTSKGKSLIISGY
WGVCRHPNYVGDWLMALGWAAFSGTAEWLPYFHPLYFGLLLMHRQLRDEQQMREKYGNED
WNAFCRVVKYRLFPYIY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcgaaaggcagaggagctgcttccaaggcagaggcgaatcctctgcagccccgcacg
aaaacctacgagtggggcggcccggtcggagccctcttcatggttgcctttctccctaca
ctggttgtagcgctgaatagcctgtgcgctgcggagcagtgcagcctcatgctggcaatg
cggatgcctgcactaatgaaggaggtggtgcagggcgcgtggccgatgctgcggacggcg
atcggcatcgagcttgcgtggatcgccgctcacgccgtattttccatcctccctattggc
aagctcgtctacggcgccgagctccgcagcggcgagcggcttgcctaccgcatgaacgcc
atccacgccttcgtcgtggctcacttagtgctctttggcctgcacttcacctccatcctc
aacatggctgttgtggccgacctctaccaccccctcatgatcggcgccattctcatctcg
ttcgccatgtcggtcgtgctgtatgcggcgtcgtaccgcagccgcaacgtactcacggct
ctcggtggcaacagtgggagcgtcctgtacgacttttgggtcggccgcgagctgaacccg
cgcaccggtccgctggactggaagctgatgtgcgaactgcggcctggtctcattggctgg
agtattctcaactgggcattcgtgtgcaagtcggtcgagctgggtaccgtgacgccgagc
atcgtgctcaccgcacttttcgagtccttctacgtgctggacggcctgctgctggaggcg
ggaaacctcagcatgatggacattgtgacggacggctttggctttatgctgtgctttggt
gaccttgcatgggtgccgtttacgtacacgctgcagacaaagtatctcgtccaccacccc
gcgcacctctcgctcgtgcatctgtgcctctgcgtttccctttctgctgccggctacctt
atctttcgaaatgcgaacacagaaaaggaccgcttccgcaaaaatccgcaggacccgcgc
gtgcagcacctgcgcatcatgaagacctccaagggcaagtctctcatcatctccggctac
tggggcgtgtgccggcacccaaactacgttggtgactggctgatggcgctcggctgggcg
gcgttcagcggcacggcagagtggttgccgtactttcatcctctttactttggcctcctc
ctcatgcaccgtcagctgcgtgatgagcagcagatgcgagagaagtacggcaatgaggac
tggaacgcgttctgtcgcgtcgtcaagtatcggctgttcccgtacatatactag

DBGET integrated database retrieval system