KEGG   Leishmania infantum: LINJ_36_4780Help
Entry
LINJ_36_4780      CDS       T01112                                 

Definition
(RefSeq) myosin heavy chain kinase A-like protein
  KO
K08240  myosin-heavy-chain kinase [EC:2.7.11.7]
Organism
lif  Leishmania infantum
Brite
KEGG Orthology (KO) [BR:lif00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LINJ_36_4780
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.7  myosin-heavy-chain kinase
     LINJ_36_4780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha_kinase
Motif
Other DBs
NCBI-GeneID: 5073958
NCBI-ProteinID: XP_001469854
UniProt: A4IDN5 A0A5K1UTY0
Position
36:1761479..1762486
Genome map
AA seq 335 aa AA seqDB search
MNPATQDAAAAEEESPVVCTAKKYIFDLHSYAWKESDCLIRIPRPHKGMGHGGMRVCYAV
EDVDEEGAGTPMVAKMFRRNISDVVEKDYFNEGAAQCMCEEFANNFNRIHLTNIHKPNIS
FLQCYVVRIPRDSIPVASQKKRTGFFSYKTQDTGEVMFVMEPMLSGKFTKYNSNYGETYR
EDKKAALTSSEAKRRTEVFEAAEAFSHFTLVESGGSMLVCDLQGVNDFLTDPQIHTEDGK
GLGMGNMGQEGIDKWIEKHECNEICRALGLQPLLGAVPSSTACAKEENLNLGLRAQLQSQ
NPVRLRDLVPLTKPLEEMTEAERIEYALKVSRLTD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgccacccaagacgctgcggcggcggaggaggagtcgccggtggtgtgcacc
gcaaagaagtacatctttgacctgcactcctacgcttggaaagaaagcgactgccttatc
cgaattcctcgcccgcacaagggcatgggccacggtggcatgcgagtctgttacgctgtg
gaggacgtggatgaggagggagctgggacaccgatggtggccaagatgtttcgccgcaac
atcagtgacgttgtagagaaagactacttcaacgagggagccgcgcagtgcatgtgcgaa
gagtttgcgaacaacttcaaccgcattcacctcaccaacattcacaagccgaacatctct
tttctgcagtgttacgtagtccgcatccctcgcgacagcatcccggtggcttcccagaag
aagcgtactggttttttctcttacaagactcaggatacgggggaggtgatgtttgtgatg
gagccgatgctgagcggcaaattcaccaagtacaacagcaactatggcgaaacctaccgt
gaagacaaaaaagcagcccttacgtcgtcggaggcgaagcggcgaacggaggtctttgaa
gccgcagaggccttctcgcattttaccctggtggaaagtggcggctcgatgctcgtgtgc
gatctgcaaggcgttaatgacttccttaccgacccgcaaattcacacggaggacggcaag
ggacttggcatgggcaacatggggcaggagggtatcgacaagtggatagagaagcacgaa
tgcaatgagatctgtcgcgcgctgggtctgcagcctttgcttggcgccgtgcccagctcg
acggcatgcgcgaaggaggagaatctcaatcttggtctgcgcgcccagctgcagagccaa
aaccctgtccgtttgcgcgatttagttcccctgaccaagccgctcgaggagatgacagag
gcggaacgcatcgagtacgccttgaaagtctcacgtctcacagattag

DBGET integrated database retrieval system